Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8674
Gene name
LocationContig_580:14634..15249
Strand-
Gene length (bp)615
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 9.2E-15 81 158

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9CQR4|ACO13_MOUSE Acyl-coenzyme A thioesterase 13 OS=Mus musculus GN=Acot13 PE=1 SV=1 71 167 4.0E-16
sp|Q5R833|ACO13_PONAB Acyl-coenzyme A thioesterase 13 OS=Pongo abelii GN=ACOT13 PE=2 SV=1 71 167 7.0E-14
sp|Q9NPJ3|ACO13_HUMAN Acyl-coenzyme A thioesterase 13 OS=Homo sapiens GN=ACOT13 PE=1 SV=1 71 167 7.0E-14
sp|P34419|YLZ6_CAEEL Putative esterase F42H10.6 OS=Caenorhabditis elegans GN=F42H10.6 PE=1 SV=2 71 176 1.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8674
MGNDQDGAQGSSNLGVDGTPEERVREWLRLTRNESGHLKAGDWMASLVPHLDFRSAVPAMPHPSVAFAYTVQSDH
CNRLQSLHGGAVATLFDFCTTMALAIVNRPGFWQFLGVSRSLNVTYLRPARCDEEILIECHIVQVGKKLASIHGV
MKRKTDGQLLSTCQHEKVNIDPEPNL*
Coding >Hirsu2|8674
ATGGGCAACGACCAAGACGGCGCGCAAGGCAGCTCCAACCTCGGCGTCGACGGAACGCCCGAAGAAAGGGTCAGG
GAATGGCTCCGGCTCACCAGGAACGAGAGCGGCCATCTCAAAGCCGGTGACTGGATGGCTTCTCTCGTCCCCCAT
CTCGACTTCCGGTCGGCCGTGCCGGCCATGCCCCACCCGTCCGTCGCCTTCGCCTACACCGTCCAGTCGGACCAC
TGCAACCGGCTGCAGAGCCTCCACGGCGGCGCCGTCGCCACCCTCTTCGACTTCTGCACCACCATGGCCCTCGCC
ATCGTCAACCGCCCGGGCTTCTGGCAGTTCCTCGGCGTCAGCCGCTCCCTCAACGTCACCTACCTGCGCCCGGCC
CGCTGCGACGAGGAGATCCTCATCGAGTGCCACATCGTCCAGGTCGGCAAGAAGCTCGCCTCCATCCACGGCGTC
ATGAAGAGGAAGACGGATGGGCAGCTGCTGTCCACCTGCCAGCATGAAAAGGTGAACATTGACCCGGAACCAAAT
CTATGA
Transcript >Hirsu2|8674
ATGGGCAACGACCAAGACGGCGCGCAAGGCAGCTCCAACCTCGGCGTCGACGGAACGCCCGAAGAAAGGGTCAGG
GAATGGCTCCGGCTCACCAGGAACGAGAGCGGCCATCTCAAAGCCGGTGACTGGATGGCTTCTCTCGTCCCCCAT
CTCGACTTCCGGTCGGCCGTGCCGGCCATGCCCCACCCGTCCGTCGCCTTCGCCTACACCGTCCAGTCGGACCAC
TGCAACCGGCTGCAGAGCCTCCACGGCGGCGCCGTCGCCACCCTCTTCGACTTCTGCACCACCATGGCCCTCGCC
ATCGTCAACCGCCCGGGCTTCTGGCAGTTCCTCGGCGTCAGCCGCTCCCTCAACGTCACCTACCTGCGCCCGGCC
CGCTGCGACGAGGAGATCCTCATCGAGTGCCACATCGTCCAGGTCGGCAAGAAGCTCGCCTCCATCCACGGCGTC
ATGAAGAGGAAGACGGATGGGCAGCTGCTGTCCACCTGCCAGCATGAAAAGGTGAACATTGACCCGGAACCAAAT
CTATGA
Gene >Hirsu2|8674
ATGGGCAACGACCAAGACGGCGCGCAAGGCAGCTCCAACCTCGGCGTCGACGGAACGCCCGAAGAAAGGGTCAGG
GAATGGCTCCGGCTCACCAGGAACGAGAGCGGCCATCTCAAAGCCGGTGTGAGTAGAACCCCCCTCCCCCCTCCC
CCCCCATGCCCTTCTTTTTTTGTTCCAACTCTTCTCGCTCTCCGCCCCCCTCAACAGGACTGGATGGCTTCTCTC
GTCCCCCATCTCGACTTCCGGTCGGCCGTGCCGGCCATGCCCCACCCGTCCGTCGCCTTCGCCTACACCGTCCAG
TCGGACCACTGCAACCGGCTGCAGAGCCTCCACGGCGGCGCCGTCGCCACCCTCTTCGACTTCTGCACCACCATG
GCCCTCGCCATCGTCAACCGCCCGGGCTTCTGGCAGTTCCTCGGCGTCAGCCGCTCCCTCAACGTCACCTACCTG
CGCCCGGCCCGCTGCGACGAGGAGATCCTCATCGAGTGCCACATCGTCCAGGTCGGCAAGAAGCTCGCCTCCATC
CACGGCGTCATGAAGAGGAAGACGGATGGGCAGCTGCTGTCCACCTGCCAGCATGAAAAGGTGAACATTGACCCG
GAACCAAATCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail