Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8672
Gene name
LocationContig_580:8421..11505
Strand+
Gene length (bp)3084
Transcript length (bp)2952
Coding sequence length (bp)2952
Protein length (aa) 984

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 8.1E-61 452 750
PF00096 zf-C2H2 Zinc finger, C2H2 type 6.8E-04 40 64
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.3E-03 70 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 269 981 2.0E-46
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 436 976 6.0E-46
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 440 974 1.0E-34
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 37 103 2.0E-09
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 3 94 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 269 981 2.0E-46
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 436 976 6.0E-46
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 440 974 1.0E-34
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 37 103 2.0E-09
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 3 94 1.0E-08
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 26 104 4.0E-08
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 29 94 2.0E-07
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 28 122 2.0E-07
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 27 94 2.0E-07
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 27 94 2.0E-07
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 14 94 5.0E-07
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 30 100 6.0E-07
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 14 96 6.0E-07
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 38 94 7.0E-07
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 28 97 8.0E-07
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 37 94 1.0E-06
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 31 106 1.0E-06
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 31 106 1.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 31 106 1.0E-06
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 38 96 2.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 31 99 2.0E-06
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 38 96 2.0E-06
sp|Q8CFA7|KLF17_MOUSE Krueppel-like factor 17 OS=Mus musculus GN=Klf17 PE=1 SV=2 12 100 2.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 31 99 2.0E-06
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 30 99 2.0E-06
sp|Q8SUR9|Z856_ENCCU Zinc finger C2H2 protein ECU08_0560 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0560 PE=3 SV=2 40 95 2.0E-06
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 40 125 2.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 31 106 2.0E-06
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 40 99 3.0E-06
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 27 99 3.0E-06
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 27 99 3.0E-06
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 40 99 3.0E-06
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 40 99 3.0E-06
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 29 99 3.0E-06
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 38 94 3.0E-06
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 38 94 3.0E-06
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 23 100 3.0E-06
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 38 113 4.0E-06
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 38 113 4.0E-06
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 16 103 6.0E-06
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 38 125 6.0E-06
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 38 113 6.0E-06
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 38 125 6.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 15 94 7.0E-06
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 15 94 8.0E-06
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 38 113 8.0E-06
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 38 113 8.0E-06
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 38 113 8.0E-06
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 38 113 8.0E-06
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 38 113 9.0E-06
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 24 100 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003676 nucleic acid binding Yes
GO:0005634 nucleus Yes
GO:0008270 zinc ion binding Yes
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0043229 intracellular organelle No
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0090304 nucleic acid metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044424 intracellular part No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0044464 cell part No
GO:1901576 organic substance biosynthetic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8672
MSDRRGGAADGPHPHKGETPLSADLPVKRKRSRKGLGKRFECTADGCGKSYSRAEHLYRHQLNHNSRQIFYCQYP
DCPRSFVRGDLLKRHMDRHAARGPHLGRRDSMAGHPAAAHSSSASDPASAEPKHFDGGCSSSIHQPPLHYHSPQA
HSGGSPYTPVGTTPPDAHRAATPNAHAAEAYGQDAALEHPQSRVTISQNSPAAPSCLSIQPSLDSYDTFPLRDAS
QSGYHANTIPHPSASFVPQQDAAASMRLPSGPYHASQAVVSPRDPGQPYMEPTSAPYLDAVRATPADMVTLDQMA
MPGTGPVFGDDGSLNKSPYVGMPEDFMAYLFNSLPGGGSCVGIAASTAASNYGDLQSHQYPHSYLGDDGAPTGHF
PTKPQRVMAVNNLLDQNAPEANLSEEKSEELFDFIRDRFHENDLPPIERQRESIIGGDRSQANHVLSRRRMQAYI
CSYWYHFSDQMPILHKPTFSSDQTPNLLLLAMMTLGAACLDRTHDQQMTTADARISDFLARHLRWEIFMDWNFRP
PAKLWVFQALILLELYEKMYSTRELHERAHIHHATTITLMRRGRSLIGKSSLDSPPNPRESQSGAKRASAGGAAQ
TAEEWWHHWIAGEATRRAAFAAFIVDTTHATMFGHSGVMAAHEMRLALPCDESLWRATSSAEVARIEANLASEGI
KPTSFLEGLKRTLSHQEVRTTSFGRTVLMAGLLSVTYHMHQRDLQVNVLGGGVTHALGGRDKWRATLKAAYDSWK
ASFDKALEQSEPSSDPYRHDAVKHVFNIVFASRTVLHHLAHMAMHADIVDCQIFARAKRLLGRTISPQEFGGAQR
RIRDTWAHTARARDAAYYALKFLSSVLQPETDRAPGAQEAYPDRPYEARYDVLMNRPWVLYFAALVVWCYGFALE
GPCPDAGQAATADEVQREMQAYLFRFSGMAGPGDLQSLKGVNENTALLMVLKESFERTQWDLLHEAAHLLRNCIM
LNTGGTLA*
Coding >Hirsu2|8672
ATGTCGGACAGACGCGGCGGAGCCGCCGACGGCCCGCACCCGCACAAGGGAGAGACACCCCTTAGTGCCGACTTG
CCCGTCAAGCGCAAGCGCAGCCGCAAGGGACTCGGCAAGCGATTCGAGTGCACCGCCGACGGCTGCGGCAAAAGC
TATTCGCGAGCCGAGCACCTATATCGCCATCAGCTGAACCACAACTCGCGCCAAATCTTCTACTGCCAGTACCCC
GACTGCCCTCGGTCCTTTGTCCGCGGCGACTTGCTGAAGCGGCACATGGACCGGCATGCCGCCAGAGGCCCTCAT
CTTGGACGACGAGACTCAATGGCGGGCCACCCTGCTGCGGCCCATTCCTCCTCTGCTTCTGACCCGGCCTCCGCC
GAGCCCAAACACTTCGACGGCGGGTGCTCATCATCTATCCACCAACCGCCTCTCCACTACCACTCACCCCAAGCG
CACTCAGGGGGCAGCCCCTACACGCCCGTCGGCACCACACCACCCGACGCTCATCGCGCCGCGACGCCGAATGCC
CACGCCGCAGAGGCCTACGGGCAGGATGCCGCGCTGGAGCATCCGCAGTCGCGCGTCACCATTTCGCAAAACTCG
CCCGCCGCGCCTTCTTGCCTCTCCATCCAACCCAGCCTTGACTCGTACGACACCTTTCCTCTACGTGACGCTAGC
CAGTCTGGCTATCATGCCAACACGATACCACACCCCTCCGCGTCTTTCGTACCTCAACAAGATGCGGCAGCTTCC
ATGCGCCTGCCGTCCGGCCCCTACCACGCCTCTCAGGCCGTCGTCTCTCCTCGCGATCCGGGCCAACCGTACATG
GAGCCTACATCGGCGCCGTACCTGGATGCGGTTCGCGCCACGCCCGCCGACATGGTGACGCTCGACCAAATGGCC
ATGCCGGGAACGGGACCGGTCTTTGGAGACGACGGGAGCCTCAACAAGTCGCCCTACGTGGGCATGCCCGAGGAT
TTCATGGCATACCTGTTCAACTCGCTACCCGGCGGCGGCTCCTGCGTCGGCATCGCGGCGTCGACTGCGGCATCC
AACTACGGCGACCTCCAGAGCCACCAGTACCCTCACTCGTACCTTGGCGACGACGGCGCACCGACGGGGCATTTT
CCGACCAAGCCGCAGCGGGTCATGGCAGTCAACAACCTGCTTGACCAGAATGCCCCCGAAGCCAATCTCTCGGAG
GAGAAGAGCGAGGAGCTGTTCGACTTCATCAGGGATCGCTTCCACGAGAACGATCTGCCCCCGATCGAGCGCCAG
AGAGAGAGCATCATTGGCGGGGACCGCAGCCAAGCCAACCACGTGCTGAGCCGGAGGAGGATGCAGGCCTACATC
TGCTCCTATTGGTACCACTTCAGCGACCAGATGCCCATACTCCACAAGCCTACCTTTTCCTCCGACCAGACGCCC
AACCTGCTTCTCCTCGCCATGATGACCCTGGGGGCGGCCTGCCTGGACAGGACCCACGATCAGCAGATGACGACG
GCCGACGCCAGGATATCCGACTTTCTCGCTCGGCACTTGCGCTGGGAGATCTTCATGGACTGGAACTTTCGGCCC
CCGGCAAAGCTGTGGGTCTTCCAGGCCCTCATCCTGCTGGAGCTGTACGAGAAGATGTACTCGACGCGAGAGCTC
CACGAGCGAGCCCACATCCACCACGCGACCACCATCACCCTGATGCGGCGCGGCCGATCCCTCATCGGCAAGTCG
AGCCTGGACTCGCCGCCGAACCCCCGAGAGAGCCAGAGCGGGGCGAAACGGGCGTCGGCCGGCGGAGCGGCGCAG
ACGGCAGAGGAATGGTGGCACCACTGGATCGCGGGGGAGGCGACGCGCCGTGCGGCGTTCGCGGCCTTCATCGTC
GACACGACGCACGCCACCATGTTCGGCCATTCCGGCGTCATGGCCGCCCACGAGATGAGGCTGGCGCTGCCCTGC
GACGAGTCGCTGTGGCGAGCGACGAGCAGCGCCGAGGTGGCCCGGATCGAGGCGAACCTGGCCTCGGAGGGCATC
AAGCCGACGTCGTTTCTCGAGGGCCTGAAGCGGACGCTGAGCCACCAGGAGGTGCGCACGACGTCGTTCGGGCGG
ACGGTGCTGATGGCCGGACTGCTCAGCGTGACGTACCACATGCACCAGCGAGACCTCCAGGTCAACGTCCTCGGC
GGAGGCGTGACGCACGCGCTGGGCGGGCGCGACAAGTGGCGGGCGACGCTGAAGGCGGCGTACGACTCGTGGAAG
GCCAGCTTCGACAAGGCGCTCGAGCAGAGCGAGCCATCGAGCGACCCGTACCGGCACGACGCCGTCAAGCACGTG
TTCAACATCGTGTTTGCCAGCCGCACCGTCCTGCACCACCTGGCGCACATGGCGATGCACGCGGACATTGTGGAC
TGCCAGATATTCGCGCGAGCCAAGCGGCTGCTGGGGCGGACCATCAGCCCGCAGGAATTCGGGGGGGCGCAGCGC
AGGATCCGGGACACGTGGGCACACACGGCGCGGGCCCGGGACGCGGCCTACTACGCCCTCAAGTTCCTGAGCTCG
GTGCTGCAGCCCGAGACAGACAGGGCACCGGGCGCGCAGGAGGCATATCCGGACAGGCCGTACGAGGCGCGGTAT
GACGTCCTGATGAACCGGCCCTGGGTGCTGTACTTTGCCGCGCTCGTCGTCTGGTGCTACGGCTTCGCGCTGGAA
GGGCCGTGTCCGGATGCGGGGCAGGCGGCGACGGCGGACGAGGTGCAGCGAGAGATGCAGGCCTACCTGTTCAGG
TTCAGCGGCATGGCAGGCCCCGGCGACCTGCAGTCGCTGAAGGGCGTCAACGAGAACACGGCGCTGCTGATGGTG
CTCAAGGAGTCGTTTGAGCGGACGCAGTGGGACCTCCTGCACGAGGCGGCCCATCTCTTGCGGAACTGCATCATG
CTCAACACAGGCGGCACGCTCGCGTGA
Transcript >Hirsu2|8672
ATGTCGGACAGACGCGGCGGAGCCGCCGACGGCCCGCACCCGCACAAGGGAGAGACACCCCTTAGTGCCGACTTG
CCCGTCAAGCGCAAGCGCAGCCGCAAGGGACTCGGCAAGCGATTCGAGTGCACCGCCGACGGCTGCGGCAAAAGC
TATTCGCGAGCCGAGCACCTATATCGCCATCAGCTGAACCACAACTCGCGCCAAATCTTCTACTGCCAGTACCCC
GACTGCCCTCGGTCCTTTGTCCGCGGCGACTTGCTGAAGCGGCACATGGACCGGCATGCCGCCAGAGGCCCTCAT
CTTGGACGACGAGACTCAATGGCGGGCCACCCTGCTGCGGCCCATTCCTCCTCTGCTTCTGACCCGGCCTCCGCC
GAGCCCAAACACTTCGACGGCGGGTGCTCATCATCTATCCACCAACCGCCTCTCCACTACCACTCACCCCAAGCG
CACTCAGGGGGCAGCCCCTACACGCCCGTCGGCACCACACCACCCGACGCTCATCGCGCCGCGACGCCGAATGCC
CACGCCGCAGAGGCCTACGGGCAGGATGCCGCGCTGGAGCATCCGCAGTCGCGCGTCACCATTTCGCAAAACTCG
CCCGCCGCGCCTTCTTGCCTCTCCATCCAACCCAGCCTTGACTCGTACGACACCTTTCCTCTACGTGACGCTAGC
CAGTCTGGCTATCATGCCAACACGATACCACACCCCTCCGCGTCTTTCGTACCTCAACAAGATGCGGCAGCTTCC
ATGCGCCTGCCGTCCGGCCCCTACCACGCCTCTCAGGCCGTCGTCTCTCCTCGCGATCCGGGCCAACCGTACATG
GAGCCTACATCGGCGCCGTACCTGGATGCGGTTCGCGCCACGCCCGCCGACATGGTGACGCTCGACCAAATGGCC
ATGCCGGGAACGGGACCGGTCTTTGGAGACGACGGGAGCCTCAACAAGTCGCCCTACGTGGGCATGCCCGAGGAT
TTCATGGCATACCTGTTCAACTCGCTACCCGGCGGCGGCTCCTGCGTCGGCATCGCGGCGTCGACTGCGGCATCC
AACTACGGCGACCTCCAGAGCCACCAGTACCCTCACTCGTACCTTGGCGACGACGGCGCACCGACGGGGCATTTT
CCGACCAAGCCGCAGCGGGTCATGGCAGTCAACAACCTGCTTGACCAGAATGCCCCCGAAGCCAATCTCTCGGAG
GAGAAGAGCGAGGAGCTGTTCGACTTCATCAGGGATCGCTTCCACGAGAACGATCTGCCCCCGATCGAGCGCCAG
AGAGAGAGCATCATTGGCGGGGACCGCAGCCAAGCCAACCACGTGCTGAGCCGGAGGAGGATGCAGGCCTACATC
TGCTCCTATTGGTACCACTTCAGCGACCAGATGCCCATACTCCACAAGCCTACCTTTTCCTCCGACCAGACGCCC
AACCTGCTTCTCCTCGCCATGATGACCCTGGGGGCGGCCTGCCTGGACAGGACCCACGATCAGCAGATGACGACG
GCCGACGCCAGGATATCCGACTTTCTCGCTCGGCACTTGCGCTGGGAGATCTTCATGGACTGGAACTTTCGGCCC
CCGGCAAAGCTGTGGGTCTTCCAGGCCCTCATCCTGCTGGAGCTGTACGAGAAGATGTACTCGACGCGAGAGCTC
CACGAGCGAGCCCACATCCACCACGCGACCACCATCACCCTGATGCGGCGCGGCCGATCCCTCATCGGCAAGTCG
AGCCTGGACTCGCCGCCGAACCCCCGAGAGAGCCAGAGCGGGGCGAAACGGGCGTCGGCCGGCGGAGCGGCGCAG
ACGGCAGAGGAATGGTGGCACCACTGGATCGCGGGGGAGGCGACGCGCCGTGCGGCGTTCGCGGCCTTCATCGTC
GACACGACGCACGCCACCATGTTCGGCCATTCCGGCGTCATGGCCGCCCACGAGATGAGGCTGGCGCTGCCCTGC
GACGAGTCGCTGTGGCGAGCGACGAGCAGCGCCGAGGTGGCCCGGATCGAGGCGAACCTGGCCTCGGAGGGCATC
AAGCCGACGTCGTTTCTCGAGGGCCTGAAGCGGACGCTGAGCCACCAGGAGGTGCGCACGACGTCGTTCGGGCGG
ACGGTGCTGATGGCCGGACTGCTCAGCGTGACGTACCACATGCACCAGCGAGACCTCCAGGTCAACGTCCTCGGC
GGAGGCGTGACGCACGCGCTGGGCGGGCGCGACAAGTGGCGGGCGACGCTGAAGGCGGCGTACGACTCGTGGAAG
GCCAGCTTCGACAAGGCGCTCGAGCAGAGCGAGCCATCGAGCGACCCGTACCGGCACGACGCCGTCAAGCACGTG
TTCAACATCGTGTTTGCCAGCCGCACCGTCCTGCACCACCTGGCGCACATGGCGATGCACGCGGACATTGTGGAC
TGCCAGATATTCGCGCGAGCCAAGCGGCTGCTGGGGCGGACCATCAGCCCGCAGGAATTCGGGGGGGCGCAGCGC
AGGATCCGGGACACGTGGGCACACACGGCGCGGGCCCGGGACGCGGCCTACTACGCCCTCAAGTTCCTGAGCTCG
GTGCTGCAGCCCGAGACAGACAGGGCACCGGGCGCGCAGGAGGCATATCCGGACAGGCCGTACGAGGCGCGGTAT
GACGTCCTGATGAACCGGCCCTGGGTGCTGTACTTTGCCGCGCTCGTCGTCTGGTGCTACGGCTTCGCGCTGGAA
GGGCCGTGTCCGGATGCGGGGCAGGCGGCGACGGCGGACGAGGTGCAGCGAGAGATGCAGGCCTACCTGTTCAGG
TTCAGCGGCATGGCAGGCCCCGGCGACCTGCAGTCGCTGAAGGGCGTCAACGAGAACACGGCGCTGCTGATGGTG
CTCAAGGAGTCGTTTGAGCGGACGCAGTGGGACCTCCTGCACGAGGCGGCCCATCTCTTGCGGAACTGCATCATG
CTCAACACAGGCGGCACGCTCGCGTGA
Gene >Hirsu2|8672
ATGTCGGACAGACGCGGCGGAGCCGCCGACGGCCCGCACCCGCACAAGGGAGAGACACCCCTTAGTGCCGACTTG
CCCGTCAAGCGCAAGCGCAGCCGCAAGGGACTCGGCAAGCGATTCGAGTGCACCGCCGACGGCTGCGGCAAAAGC
TATTCGCGAGCCGAGCACCTGTAAGACAGCCAGCGGCCGAATCCCGTCCTCCACGCTCACCCCTCTGCCGCGGGC
TTGTCACTGACGCGCGGCAGATATCGCCATCAGCTGAACCACAACTCGCGCCAAATCTTCTACTGCCAGTACCCC
GACTGCCCTCGGTCCTTTGTCCGCGGCGACTTGCTGAAGCGGCACATGGACCGGCATGCCGCCAGAGGCCCTCAT
CTTGGACGACGAGACTCAATGGCGGGCCACCCTGCTGCGGCCCATTCCTCCTCTGCTTCTGACCCGGCCTCCGCC
GAGCCCAAACACTTCGACGGCGGGTGCTCATCATCTATCCACCAACCGCCTCTCCACTACCACTCACCCCAAGCG
CACTCAGGGGGCAGCCCCTACACGCCCGTCGGCACCACACCACCCGACGCTCATCGCGCCGCGACGCCGAATGCC
CACGCCGCAGAGGCCTACGGGCAGGATGCCGCGCTGGAGCATCCGCAGTCGCGCGTCACCATTTCGCAAAACTCG
CCCGCCGCGCCTTCTTGCCTCTCCATCCAACCCAGCCTTGACTCGTACGACACCTTTCCTCTACGTGACGCTAGC
CAGTCTGGCTATCATGCCAACACGATACCACACCCCTCCGCGTCTTTCGTACCTCAACAAGATGCGGCAGCTTCC
ATGCGCCTGCCGTCCGGCCCCTACCACGCCTCTCAGGCCGTCGTCTCTCCTCGCGATCCGGGCCAACCGTACATG
GAGCCTACATCGGCGCCGTACCTGGATGCGGTTCGCGCCACGCCCGCCGACATGGTGACGCTCGACCAAATGGCC
ATGCCGGGAACGGGACCGGTCTTTGGAGACGACGGGAGCCTCAACAAGTCGCCCTACGTGGGCATGCCCGAGGAT
TTCATGGCATACCTGTTCAACTCGCTACCCGGCGGCGGCTCCTGCGTCGGCATCGCGGCGTCGACTGCGGCATCC
AAGTACGCCACGGCCGACCTGGTTCCCAGTCTGCTAAACCTGACTGACCTTGCCTATAGCTACGGCGACCTCCAG
AGCCACCAGTACCCTCACTCGTACCTTGGCGACGACGGCGCACCGACGGGGCATTTTCCGACCAAGCCGCAGCGG
GTCATGGCAGTCAACAACCTGCTTGACCAGAATGCCCCCGAAGCCAATCTCTCGGAGGAGAAGAGCGAGGAGCTG
TTCGACTTCATCAGGGATCGCTTCCACGAGAACGATCTGCCCCCGATCGAGCGCCAGAGAGAGAGCATCATTGGC
GGGGACCGCAGCCAAGCCAACCACGTGCTGAGCCGGAGGAGGATGCAGGCCTACATCTGCTCCTATTGGTACCAC
TTCAGCGACCAGATGCCCATACTCCACAAGCCTACCTTTTCCTCCGACCAGACGCCCAACCTGCTTCTCCTCGCC
ATGATGACCCTGGGGGCGGCCTGCCTGGACAGGACCCACGATCAGCAGATGACGACGGCCGACGCCAGGATATCC
GACTTTCTCGCTCGGCACTTGCGCTGGGAGATCTTCATGGACTGGAACTTTCGGCCCCCGGCAAAGCTGTGGGTC
TTCCAGGCCCTCATCCTGCTGGAGCTGTACGAGAAGATGTACTCGACGCGAGAGCTCCACGAGCGAGCCCACATC
CACCACGCGACCACCATCACCCTGATGCGGCGCGGCCGATCCCTCATCGGCAAGTCGAGCCTGGACTCGCCGCCG
AACCCCCGAGAGAGCCAGAGCGGGGCGAAACGGGCGTCGGCCGGCGGAGCGGCGCAGACGGCAGAGGAATGGTGG
CACCACTGGATCGCGGGGGAGGCGACGCGCCGTGCGGCGTTCGCGGCCTTCATCGTCGACACGACGCACGCCACC
ATGTTCGGCCATTCCGGCGTCATGGCCGCCCACGAGATGAGGCTGGCGCTGCCCTGCGACGAGTCGCTGTGGCGA
GCGACGAGCAGCGCCGAGGTGGCCCGGATCGAGGCGAACCTGGCCTCGGAGGGCATCAAGCCGACGTCGTTTCTC
GAGGGCCTGAAGCGGACGCTGAGCCACCAGGAGGTGCGCACGACGTCGTTCGGGCGGACGGTGCTGATGGCCGGA
CTGCTCAGCGTGACGTACCACATGCACCAGCGAGACCTCCAGGTCAACGTCCTCGGCGGAGGCGTGACGCACGCG
CTGGGCGGGCGCGACAAGTGGCGGGCGACGCTGAAGGCGGCGTACGACTCGTGGAAGGCCAGCTTCGACAAGGCG
CTCGAGCAGAGCGAGCCATCGAGCGACCCGTACCGGCACGACGCCGTCAAGCACGTGTTCAACATCGTGTTTGCC
AGCCGCACCGTCCTGCACCACCTGGCGCACATGGCGATGCACGCGGACATTGTGGACTGCCAGATATTCGCGCGA
GCCAAGCGGCTGCTGGGGCGGACCATCAGCCCGCAGGAATTCGGGGGGGCGCAGCGCAGGATCCGGGACACGTGG
GCACACACGGCGCGGGCCCGGGACGCGGCCTACTACGCCCTCAAGTTCCTGAGCTCGGTGCTGCAGCCCGAGACA
GACAGGGCACCGGGCGCGCAGGAGGCATATCCGGACAGGCCGTACGAGGCGCGGTATGACGTCCTGATGAACCGG
CCCTGGGTGCTGTACTTTGCCGCGCTCGTCGTCTGGTGCTACGGCTTCGCGCTGGAAGGGCCGTGTCCGGATGCG
GGGCAGGCGGCGACGGCGGACGAGGTGCAGCGAGAGATGCAGGCCTACCTGTTCAGGTTCAGCGGCATGGCAGGC
CCCGGCGACCTGCAGTCGCTGAAGGGCGTCAACGAGAACACGGCGCTGCTGATGGTGCTCAAGGAGTCGTTTGAG
CGGACGCAGTGGGACCTCCTGCACGAGGCGGCCCATCTCTTGCGGAACTGCATCATGCTCAACACAGGCGGCACG
CTCGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail