Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|867
Gene name
LocationContig_1180:4358..6610
Strand+
Gene length (bp)2252
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05024 Gpi1 N-acetylglucosaminyl transferase component (Gpi1) 8.5E-113 266 541

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14357|GPI1_SCHPO N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi1 PE=2 SV=1 41 634 3.0E-119
sp|P53306|GPI1_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI1 PE=1 SV=1 44 645 6.0E-78
sp|Q9QYT7|PIGQ_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Mus musculus GN=Pigq PE=1 SV=3 348 586 1.0E-51
sp|Q9BRB3|PIGQ_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Homo sapiens GN=PIGQ PE=1 SV=3 304 539 1.0E-42

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:1901135 carbohydrate derivative metabolic process No
GO:0043412 macromolecule modification No
GO:0006505 GPI anchor metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0006664 glycolipid metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0006629 lipid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0019538 protein metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0046467 membrane lipid biosynthetic process No
GO:0008150 biological_process No
GO:0110165 cellular anatomical entity No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:1903509 liposaccharide metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0044237 cellular metabolic process No
GO:0005575 cellular_component No
GO:1901576 organic substance biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0006497 protein lipidation No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Transmembrane domain 0.1764 0.232 0.156 0.1785 0.2605 0.0317 0.3728 0.3988 0.2188 0.1741

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 214 236 22
2 306 328 22
3 370 392 22
4 399 418 19
5 480 502 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5695
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2744
Ophiocordyceps australis map64 (Brazil) OphauB2|6597
Ophiocordyceps camponoti-floridani Ophcf2|05202
Ophiocordyceps camponoti-rufipedis Ophun1|5095
Ophiocordyceps kimflemingae Ophio5|4714
Ophiocordyceps subramaniannii Hirsu2|867 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|867
LLTRPPSTQAKDVEFHLKLGTFFRSGPHSPSRIYDVCGHPSMHVLGVSNPSNPEAADPSWVRATTTPSSRRPTIT
CAKASSVQLILYDRPRPKRMQYISLDPIALALGDKGSALEDTRVAGPEGEIEEQELKAKEARRKLVEKLKLHTIT
HRVPSARDRALPKIVNQVNWSWELEQTLQKNVGRLGPRPRRGLSVSERMVESATTMRNYVLHRLWAWSTLYLFPV
LWRGFCLLLFGHRMVAEVLLFALEFRPKPGGAALKDISATAQQIEIRLQQFCYWPMQYSTLRRRKMNWSSVTTSH
PDYIRFYNSLWLVANDVIIGMALGSYIIEHADWVAAQIGDLLRTYAVEALRRSISWLMGWPAGLKLNGELAAFLG
DLFLWVIHYWSTCIEALQPVLPRLVWFIGFSSFAGASMPIAVFSDLLSALTIHIYSFYLASARIYHWQLTILQSL
FHLFRGKKHNVLRNRIDSCDYDLDQLLVGTIFFTLLSFLLPTVVVFYLNFAIARMIIISMKAGFDTLLSCLNHFP
LFALMLRVKDPRRLPGGIRFELRDSQGQRASATTGLYKEPPTSVIYLKSIPLSFSAMFHQYFQMAQRIRKHYLSP
GVLLRLLTGQFVPPINRKNLYSLQYSMLPAKRATAWEMWRALNMELPQKKSFYLPPIPSLSNGSKRAAGNGRARS
HH*
Coding >Hirsu2|867
CTGCTGACGAGACCCCCTTCCACCCAGGCGAAAGATGTCGAATTCCACCTCAAGCTCGGCACCTTCTTCCGCAGC
GGCCCTCACAGCCCCAGCCGCATCTACGACGTCTGCGGCCACCCTTCGATGCACGTCCTCGGCGTCTCCAACCCC
TCGAACCCGGAAGCCGCCGACCCGTCCTGGGTGCGCGCGACCACCACGCCCTCCTCGAGACGCCCGACCATCACC
TGCGCCAAGGCGTCCAGCGTTCAGCTCATCCTCTACGATCGGCCCCGCCCCAAGCGTATGCAGTACATATCGCTC
GACCCCATCGCCTTGGCTCTCGGCGACAAGGGCTCTGCGCTCGAGGATACGCGGGTCGCCGGCCCTGAAGGCGAA
ATCGAAGAGCAGGAGCTCAAGGCCAAGGAGGCGCGGCGCAAGCTGGTGGAGAAGCTCAAGCTACACACAATCACC
CACCGTGTGCCCTCCGCCCGGGACAGGGCGTTGCCCAAGATCGTTAATCAGGTCAACTGGTCGTGGGAGCTGGAG
CAGACGCTGCAAAAGAATGTCGGGCGCCTCGGCCCGCGACCGAGGCGCGGCCTCAGCGTGTCGGAAAGGATGGTC
GAGTCGGCCACAACCATGAGGAACTACGTTCTGCACCGGCTCTGGGCCTGGTCCACACTGTATTTGTTCCCGGTC
CTGTGGCGGGGATTCTGTCTGCTTCTCTTCGGCCACCGAATGGTAGCCGAGGTGCTACTCTTCGCTCTCGAGTTC
CGGCCCAAACCGGGTGGCGCCGCTCTCAAAGACATCTCGGCGACGGCCCAGCAGATCGAGATTCGCCTTCAGCAG
TTTTGCTACTGGCCCATGCAGTATTCGACGTTGCGCCGGCGCAAGATGAACTGGTCAAGCGTCACCACCAGCCAT
CCCGACTACATCCGCTTCTACAACAGCCTGTGGCTCGTTGCCAACGACGTCATCATCGGCATGGCCCTGGGCTCG
TACATCATCGAACACGCCGACTGGGTGGCGGCCCAGATCGGCGACCTCCTGCGGACCTACGCCGTCGAGGCCCTC
CGGCGGAGCATTTCCTGGCTCATGGGCTGGCCGGCCGGCCTCAAACTCAACGGCGAACTGGCGGCCTTCTTGGGG
GACCTGTTCCTCTGGGTCATCCACTATTGGTCAACATGCATCGAGGCGTTACAGCCGGTGCTGCCGCGCCTGGTG
TGGTTCATCGGCTTCTCGTCCTTCGCCGGGGCCAGCATGCCCATCGCCGTCTTCTCCGACCTCCTGTCCGCCCTG
ACCATCCACATCTACTCGTTCTACCTGGCCTCGGCCCGCATCTACCACTGGCAGCTCACGATCCTGCAGTCGCTG
TTCCACCTGTTCCGCGGCAAGAAACACAACGTGCTTCGCAACCGTATCGACTCGTGCGACTACGACCTGGATCAG
CTGCTCGTCGGCACCATCTTCTTCACCCTGCTGTCCTTCCTGCTGCCCACCGTCGTCGTCTTCTACCTGAACTTT
GCGATTGCGAGGATGATCATCATCTCGATGAAGGCCGGCTTCGACACGCTCCTCTCCTGCCTGAACCACTTCCCG
CTGTTCGCCCTGATGCTGAGGGTCAAGGACCCCCGACGGCTGCCCGGTGGCATTCGCTTCGAGCTCCGAGACAGC
CAGGGCCAGAGGGCCTCGGCCACCACTGGTCTCTACAAGGAGCCGCCGACGTCGGTCATCTACCTCAAATCGATC
CCGCTGTCCTTTAGCGCCATGTTCCACCAGTACTTCCAGATGGCGCAGCGGATCCGGAAGCACTACCTGTCTCCG
GGCGTGCTGCTCCGGCTGCTGACGGGCCAGTTCGTGCCGCCAATCAACCGGAAGAACCTGTACAGCCTGCAGTAC
AGCATGCTGCCGGCGAAGCGGGCGACGGCGTGGGAGATGTGGCGAGCCCTCAATATGGAGCTGCCGCAGAAAAAG
TCGTTCTACCTGCCGCCGATCCCGTCGCTGTCAAACGGGAGCAAGCGGGCCGCCGGCAACGGGCGGGCCAGGTCT
CACCACTGA
Transcript >Hirsu2|867
CTGCTGACGAGACCCCCTTCCACCCAGGCGAAAGATGTCGAATTCCACCTCAAGCTCGGCACCTTCTTCCGCAGC
GGCCCTCACAGCCCCAGCCGCATCTACGACGTCTGCGGCCACCCTTCGATGCACGTCCTCGGCGTCTCCAACCCC
TCGAACCCGGAAGCCGCCGACCCGTCCTGGGTGCGCGCGACCACCACGCCCTCCTCGAGACGCCCGACCATCACC
TGCGCCAAGGCGTCCAGCGTTCAGCTCATCCTCTACGATCGGCCCCGCCCCAAGCGTATGCAGTACATATCGCTC
GACCCCATCGCCTTGGCTCTCGGCGACAAGGGCTCTGCGCTCGAGGATACGCGGGTCGCCGGCCCTGAAGGCGAA
ATCGAAGAGCAGGAGCTCAAGGCCAAGGAGGCGCGGCGCAAGCTGGTGGAGAAGCTCAAGCTACACACAATCACC
CACCGTGTGCCCTCCGCCCGGGACAGGGCGTTGCCCAAGATCGTTAATCAGGTCAACTGGTCGTGGGAGCTGGAG
CAGACGCTGCAAAAGAATGTCGGGCGCCTCGGCCCGCGACCGAGGCGCGGCCTCAGCGTGTCGGAAAGGATGGTC
GAGTCGGCCACAACCATGAGGAACTACGTTCTGCACCGGCTCTGGGCCTGGTCCACACTGTATTTGTTCCCGGTC
CTGTGGCGGGGATTCTGTCTGCTTCTCTTCGGCCACCGAATGGTAGCCGAGGTGCTACTCTTCGCTCTCGAGTTC
CGGCCCAAACCGGGTGGCGCCGCTCTCAAAGACATCTCGGCGACGGCCCAGCAGATCGAGATTCGCCTTCAGCAG
TTTTGCTACTGGCCCATGCAGTATTCGACGTTGCGCCGGCGCAAGATGAACTGGTCAAGCGTCACCACCAGCCAT
CCCGACTACATCCGCTTCTACAACAGCCTGTGGCTCGTTGCCAACGACGTCATCATCGGCATGGCCCTGGGCTCG
TACATCATCGAACACGCCGACTGGGTGGCGGCCCAGATCGGCGACCTCCTGCGGACCTACGCCGTCGAGGCCCTC
CGGCGGAGCATTTCCTGGCTCATGGGCTGGCCGGCCGGCCTCAAACTCAACGGCGAACTGGCGGCCTTCTTGGGG
GACCTGTTCCTCTGGGTCATCCACTATTGGTCAACATGCATCGAGGCGTTACAGCCGGTGCTGCCGCGCCTGGTG
TGGTTCATCGGCTTCTCGTCCTTCGCCGGGGCCAGCATGCCCATCGCCGTCTTCTCCGACCTCCTGTCCGCCCTG
ACCATCCACATCTACTCGTTCTACCTGGCCTCGGCCCGCATCTACCACTGGCAGCTCACGATCCTGCAGTCGCTG
TTCCACCTGTTCCGCGGCAAGAAACACAACGTGCTTCGCAACCGTATCGACTCGTGCGACTACGACCTGGATCAG
CTGCTCGTCGGCACCATCTTCTTCACCCTGCTGTCCTTCCTGCTGCCCACCGTCGTCGTCTTCTACCTGAACTTT
GCGATTGCGAGGATGATCATCATCTCGATGAAGGCCGGCTTCGACACGCTCCTCTCCTGCCTGAACCACTTCCCG
CTGTTCGCCCTGATGCTGAGGGTCAAGGACCCCCGACGGCTGCCCGGTGGCATTCGCTTCGAGCTCCGAGACAGC
CAGGGCCAGAGGGCCTCGGCCACCACTGGTCTCTACAAGGAGCCGCCGACGTCGGTCATCTACCTCAAATCGATC
CCGCTGTCCTTTAGCGCCATGTTCCACCAGTACTTCCAGATGGCGCAGCGGATCCGGAAGCACTACCTGTCTCCG
GGCGTGCTGCTCCGGCTGCTGACGGGCCAGTTCGTGCCGCCAATCAACCGGAAGAACCTGTACAGCCTGCAGTAC
AGCATGCTGCCGGCGAAGCGGGCGACGGCGTGGGAGATGTGGCGAGCCCTCAATATGGAGCTGCCGCAGAAAAAG
TCGTTCTACCTGCCGCCGATCCCGTCGCTGTCAAACGGGAGCAAGCGGGCCGCCGGCAACGGGCGGGCCAGGTCT
CACCACTGA
Gene >Hirsu2|867
CTGCTGACGAGACCCCCTTCCACCCAGGCGAAAGATGTCGAATTCCACCTCAAGCTCGGCACCTTCTTCCGCAGC
GGCCCTCACAGCCCCAGCCGCATCTACGACGTCTGCGGCCACCCTTCGATGCACGTCCTCGGCGTCTCCAACCCC
TCGAACCCGGAAGCCGCCGACCCGTCCTGGGTGCGCGCGACCACCACGCCCTCCTCGAGACGCCCGACCATCACC
TGCGCCAAGGCGTCCAGCGTTCAGCTCATCCTCTACGATCGGCCCCGCCCCAAGCGTATGCAGTACATATCGCTC
GACCCCATCGCCTTGGCTCTCGGCGACAAGGGCTCTGCGCTCGAGGATACGCGGGTCGCCGGCCCTGAAGGCGAA
ATCGAAGAGCAGGAGCTCAAGGCCAAGGAGGCGCGGCGCAAGCTGGTGGAGAAGCTCAAGCTACACACAATCACC
CACCGTGTGCCCTCCGCCCGGGACAGGGCGTTGCCCAAGATCGTTAATCAGGTCAACTGGTCGTGGGAGCTGGAG
CAGACGCTGCAAAAGAATGTCGGGCGCCTCGGCCCGCGACCGAGGCGCGGCCTCAGCGTGTCGGAAAGGATGGTC
GAGTCGGCCACAACCATGAGGAACTACGTTCTGCACCGGCTCTGGGCCTGGTCCACACTGTATTTGTTCCCGGTC
CTGTGGCGGGGATTCTGTCTGCTTCTCTTCGGCCACCGAATGGTAGCCGAGGTGCTACTCTTCGCTCTCGAGTTC
CGGCCCAAACCGGGTGGCGCCGCTCTCAAAGACATCTCGGCGACGGCCCAGCAGATCGAGATTCGCCTTCAGCAG
TTTTGCTACTGGCCCATGCAGTATTCGACGTTGCGCCGGCGCAAGATGAACTGGTCAAGCGTCACCACCAGCCAT
CCCGACTACATCCGCTTCTACAACAGCCTGTGGCTCGTTGCCAACGACGTCATCATCGGCATGGCCCTGGGCTCG
TACATCATCGAACACGCCGACTGGGTGGCGGCCCAGATCGGCGACCTCCTGCGGACCTACGCCGTCGAGGCCCTC
CGGCGGAGCATTTCCTGGCTCATGGGCTGGCCGGCCGGCCTCAAACTCAACGGCGAACTGGCGGCCTTCTTGGGG
GACCTGTTCCTCTGGGTCATCCACTATTGGTCAAGTGAGTCCTGCGCATATAGAGTCGGCACGTCGTGCCCGGTG
TCGGAGTGGGCCAGGCTAACACTCCGGCAGCATGCATCGAGGCGTTACAGCCGGTGCTGCCGCGCCTGGTGTGGT
TCATCGGCTTCTCGTCCTTCGCCGGGGCCAGCATGCCCATCGCCGTCTTCTCCGACCTCCTGTCCGCCCTGACCA
TCCACATCTACTCGTTCTACCTGGCCTCGGCCCGCATCTACCACTGGCAGCTCACGATCCTGCAGTCGCTGTTCC
ACCTGTTCCGCGGCAAGAAACACAACGTGCTTCGCAACCGTATCGACTCGTGCGACTACGACCTGGATCAGCTGC
TCGTCGGCACCATCTTCTTCACCCTGCTGTCCTTCCTGCTGCCCACCGTCGTCGTCTTCTACCTGAACTTTGCGA
TTGCGAGGATGATCATCATCTCGATGAAGGCCGGCTTCGACACGCTCCTCTCCTGCCTGAACCACTTCCCGCTGT
TCGCCCTGATGCTGAGGGTCAAGGACCCCCGACGGCTGCCCGGTAAGGTCGAAGGGAGTCGAGAGGGCGCGTGCT
ACGCCGCTGGAGGACACACGGGCACTGACTCGGTCGCCGCACAGGTGGCATTCGCTTCGAGCTCCGAGACAGCCA
GGGCCAGAGGGCCTCGGCCACCACTGGTCTCTACAAGGAGCCGCCGACGTCGGTCATCTACCTCAAAGTCAGTAT
ACCCCACCCCGTCGACGTCTTGCCGAGCCGGGCGCCCCCGACTGACGGACGAACGGTGACAGTCGATCCCGCTGT
CCTTTAGCGCCATGTTCCACCAGTACTTCCAGATGGCGCAGCGGATCCGGAAGCACTACCTGTCTCCGGGCGTGC
TGCTCCGGCTGCTGACGGGCCAGTTCGTGCCGCCAATCAACCGGAAGAACCTGTACAGCCTGCAGTACAGCATGC
TGCCGGCGAAGCGGGCGACGGCGTGGGAGATGTGGCGAGCCCTCAATATGGAGCTGCCGCAGAAAAAGTCGTTCT
ACCTGCCGCCGATCCCGTCGCTGTCAAACGGGAGCAAGCGGGCCGCCGGCAACGGGCGGGCCAGGTCTCACCACT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail