Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|867
Gene name
LocationContig_1180:4358..6610
Strand+
Gene length (bp)2252
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05024 Gpi1 N-acetylglucosaminyl transferase component (Gpi1) 4.8E-77 307 493

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14357|GPI1_SCHPO N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi1 PE=2 SV=1 41 634 3.0E-119
sp|P53306|GPI1_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI1 PE=1 SV=1 44 645 6.0E-78
sp|Q9QYT7|PIGQ_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Mus musculus GN=Pigq PE=1 SV=3 348 586 1.0E-51
sp|Q9BRB3|PIGQ_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Homo sapiens GN=PIGQ PE=1 SV=3 304 539 1.0E-42

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0017176 phosphatidylinositol N-acetylglucosaminyltransferase activity Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:0006644 phospholipid metabolic process No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:1903509 liposaccharide metabolic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0009058 biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0044425 membrane part No
GO:0006664 glycolipid metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0031224 intrinsic component of membrane No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0006497 protein lipidation No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044267 cellular protein metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0008654 phospholipid biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0006505 GPI anchor metabolic process No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 214 236 22
2 306 328 22
3 370 392 22
4 399 418 19
5 480 502 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|867
LLTRPPSTQAKDVEFHLKLGTFFRSGPHSPSRIYDVCGHPSMHVLGVSNPSNPEAADPSWVRATTTPSSRRPTIT
CAKASSVQLILYDRPRPKRMQYISLDPIALALGDKGSALEDTRVAGPEGEIEEQELKAKEARRKLVEKLKLHTIT
HRVPSARDRALPKIVNQVNWSWELEQTLQKNVGRLGPRPRRGLSVSERMVESATTMRNYVLHRLWAWSTLYLFPV
LWRGFCLLLFGHRMVAEVLLFALEFRPKPGGAALKDISATAQQIEIRLQQFCYWPMQYSTLRRRKMNWSSVTTSH
PDYIRFYNSLWLVANDVIIGMALGSYIIEHADWVAAQIGDLLRTYAVEALRRSISWLMGWPAGLKLNGELAAFLG
DLFLWVIHYWSTCIEALQPVLPRLVWFIGFSSFAGASMPIAVFSDLLSALTIHIYSFYLASARIYHWQLTILQSL
FHLFRGKKHNVLRNRIDSCDYDLDQLLVGTIFFTLLSFLLPTVVVFYLNFAIARMIIISMKAGFDTLLSCLNHFP
LFALMLRVKDPRRLPGGIRFELRDSQGQRASATTGLYKEPPTSVIYLKSIPLSFSAMFHQYFQMAQRIRKHYLSP
GVLLRLLTGQFVPPINRKNLYSLQYSMLPAKRATAWEMWRALNMELPQKKSFYLPPIPSLSNGSKRAAGNGRARS
HH*
Coding >Hirsu2|867
CTGCTGACGAGACCCCCTTCCACCCAGGCGAAAGATGTCGAATTCCACCTCAAGCTCGGCACCTTCTTCCGCAGC
GGCCCTCACAGCCCCAGCCGCATCTACGACGTCTGCGGCCACCCTTCGATGCACGTCCTCGGCGTCTCCAACCCC
TCGAACCCGGAAGCCGCCGACCCGTCCTGGGTGCGCGCGACCACCACGCCCTCCTCGAGACGCCCGACCATCACC
TGCGCCAAGGCGTCCAGCGTTCAGCTCATCCTCTACGATCGGCCCCGCCCCAAGCGTATGCAGTACATATCGCTC
GACCCCATCGCCTTGGCTCTCGGCGACAAGGGCTCTGCGCTCGAGGATACGCGGGTCGCCGGCCCTGAAGGCGAA
ATCGAAGAGCAGGAGCTCAAGGCCAAGGAGGCGCGGCGCAAGCTGGTGGAGAAGCTCAAGCTACACACAATCACC
CACCGTGTGCCCTCCGCCCGGGACAGGGCGTTGCCCAAGATCGTTAATCAGGTCAACTGGTCGTGGGAGCTGGAG
CAGACGCTGCAAAAGAATGTCGGGCGCCTCGGCCCGCGACCGAGGCGCGGCCTCAGCGTGTCGGAAAGGATGGTC
GAGTCGGCCACAACCATGAGGAACTACGTTCTGCACCGGCTCTGGGCCTGGTCCACACTGTATTTGTTCCCGGTC
CTGTGGCGGGGATTCTGTCTGCTTCTCTTCGGCCACCGAATGGTAGCCGAGGTGCTACTCTTCGCTCTCGAGTTC
CGGCCCAAACCGGGTGGCGCCGCTCTCAAAGACATCTCGGCGACGGCCCAGCAGATCGAGATTCGCCTTCAGCAG
TTTTGCTACTGGCCCATGCAGTATTCGACGTTGCGCCGGCGCAAGATGAACTGGTCAAGCGTCACCACCAGCCAT
CCCGACTACATCCGCTTCTACAACAGCCTGTGGCTCGTTGCCAACGACGTCATCATCGGCATGGCCCTGGGCTCG
TACATCATCGAACACGCCGACTGGGTGGCGGCCCAGATCGGCGACCTCCTGCGGACCTACGCCGTCGAGGCCCTC
CGGCGGAGCATTTCCTGGCTCATGGGCTGGCCGGCCGGCCTCAAACTCAACGGCGAACTGGCGGCCTTCTTGGGG
GACCTGTTCCTCTGGGTCATCCACTATTGGTCAACATGCATCGAGGCGTTACAGCCGGTGCTGCCGCGCCTGGTG
TGGTTCATCGGCTTCTCGTCCTTCGCCGGGGCCAGCATGCCCATCGCCGTCTTCTCCGACCTCCTGTCCGCCCTG
ACCATCCACATCTACTCGTTCTACCTGGCCTCGGCCCGCATCTACCACTGGCAGCTCACGATCCTGCAGTCGCTG
TTCCACCTGTTCCGCGGCAAGAAACACAACGTGCTTCGCAACCGTATCGACTCGTGCGACTACGACCTGGATCAG
CTGCTCGTCGGCACCATCTTCTTCACCCTGCTGTCCTTCCTGCTGCCCACCGTCGTCGTCTTCTACCTGAACTTT
GCGATTGCGAGGATGATCATCATCTCGATGAAGGCCGGCTTCGACACGCTCCTCTCCTGCCTGAACCACTTCCCG
CTGTTCGCCCTGATGCTGAGGGTCAAGGACCCCCGACGGCTGCCCGGTGGCATTCGCTTCGAGCTCCGAGACAGC
CAGGGCCAGAGGGCCTCGGCCACCACTGGTCTCTACAAGGAGCCGCCGACGTCGGTCATCTACCTCAAATCGATC
CCGCTGTCCTTTAGCGCCATGTTCCACCAGTACTTCCAGATGGCGCAGCGGATCCGGAAGCACTACCTGTCTCCG
GGCGTGCTGCTCCGGCTGCTGACGGGCCAGTTCGTGCCGCCAATCAACCGGAAGAACCTGTACAGCCTGCAGTAC
AGCATGCTGCCGGCGAAGCGGGCGACGGCGTGGGAGATGTGGCGAGCCCTCAATATGGAGCTGCCGCAGAAAAAG
TCGTTCTACCTGCCGCCGATCCCGTCGCTGTCAAACGGGAGCAAGCGGGCCGCCGGCAACGGGCGGGCCAGGTCT
CACCACTGA
Transcript >Hirsu2|867
CTGCTGACGAGACCCCCTTCCACCCAGGCGAAAGATGTCGAATTCCACCTCAAGCTCGGCACCTTCTTCCGCAGC
GGCCCTCACAGCCCCAGCCGCATCTACGACGTCTGCGGCCACCCTTCGATGCACGTCCTCGGCGTCTCCAACCCC
TCGAACCCGGAAGCCGCCGACCCGTCCTGGGTGCGCGCGACCACCACGCCCTCCTCGAGACGCCCGACCATCACC
TGCGCCAAGGCGTCCAGCGTTCAGCTCATCCTCTACGATCGGCCCCGCCCCAAGCGTATGCAGTACATATCGCTC
GACCCCATCGCCTTGGCTCTCGGCGACAAGGGCTCTGCGCTCGAGGATACGCGGGTCGCCGGCCCTGAAGGCGAA
ATCGAAGAGCAGGAGCTCAAGGCCAAGGAGGCGCGGCGCAAGCTGGTGGAGAAGCTCAAGCTACACACAATCACC
CACCGTGTGCCCTCCGCCCGGGACAGGGCGTTGCCCAAGATCGTTAATCAGGTCAACTGGTCGTGGGAGCTGGAG
CAGACGCTGCAAAAGAATGTCGGGCGCCTCGGCCCGCGACCGAGGCGCGGCCTCAGCGTGTCGGAAAGGATGGTC
GAGTCGGCCACAACCATGAGGAACTACGTTCTGCACCGGCTCTGGGCCTGGTCCACACTGTATTTGTTCCCGGTC
CTGTGGCGGGGATTCTGTCTGCTTCTCTTCGGCCACCGAATGGTAGCCGAGGTGCTACTCTTCGCTCTCGAGTTC
CGGCCCAAACCGGGTGGCGCCGCTCTCAAAGACATCTCGGCGACGGCCCAGCAGATCGAGATTCGCCTTCAGCAG
TTTTGCTACTGGCCCATGCAGTATTCGACGTTGCGCCGGCGCAAGATGAACTGGTCAAGCGTCACCACCAGCCAT
CCCGACTACATCCGCTTCTACAACAGCCTGTGGCTCGTTGCCAACGACGTCATCATCGGCATGGCCCTGGGCTCG
TACATCATCGAACACGCCGACTGGGTGGCGGCCCAGATCGGCGACCTCCTGCGGACCTACGCCGTCGAGGCCCTC
CGGCGGAGCATTTCCTGGCTCATGGGCTGGCCGGCCGGCCTCAAACTCAACGGCGAACTGGCGGCCTTCTTGGGG
GACCTGTTCCTCTGGGTCATCCACTATTGGTCAACATGCATCGAGGCGTTACAGCCGGTGCTGCCGCGCCTGGTG
TGGTTCATCGGCTTCTCGTCCTTCGCCGGGGCCAGCATGCCCATCGCCGTCTTCTCCGACCTCCTGTCCGCCCTG
ACCATCCACATCTACTCGTTCTACCTGGCCTCGGCCCGCATCTACCACTGGCAGCTCACGATCCTGCAGTCGCTG
TTCCACCTGTTCCGCGGCAAGAAACACAACGTGCTTCGCAACCGTATCGACTCGTGCGACTACGACCTGGATCAG
CTGCTCGTCGGCACCATCTTCTTCACCCTGCTGTCCTTCCTGCTGCCCACCGTCGTCGTCTTCTACCTGAACTTT
GCGATTGCGAGGATGATCATCATCTCGATGAAGGCCGGCTTCGACACGCTCCTCTCCTGCCTGAACCACTTCCCG
CTGTTCGCCCTGATGCTGAGGGTCAAGGACCCCCGACGGCTGCCCGGTGGCATTCGCTTCGAGCTCCGAGACAGC
CAGGGCCAGAGGGCCTCGGCCACCACTGGTCTCTACAAGGAGCCGCCGACGTCGGTCATCTACCTCAAATCGATC
CCGCTGTCCTTTAGCGCCATGTTCCACCAGTACTTCCAGATGGCGCAGCGGATCCGGAAGCACTACCTGTCTCCG
GGCGTGCTGCTCCGGCTGCTGACGGGCCAGTTCGTGCCGCCAATCAACCGGAAGAACCTGTACAGCCTGCAGTAC
AGCATGCTGCCGGCGAAGCGGGCGACGGCGTGGGAGATGTGGCGAGCCCTCAATATGGAGCTGCCGCAGAAAAAG
TCGTTCTACCTGCCGCCGATCCCGTCGCTGTCAAACGGGAGCAAGCGGGCCGCCGGCAACGGGCGGGCCAGGTCT
CACCACTGA
Gene >Hirsu2|867
CTGCTGACGAGACCCCCTTCCACCCAGGCGAAAGATGTCGAATTCCACCTCAAGCTCGGCACCTTCTTCCGCAGC
GGCCCTCACAGCCCCAGCCGCATCTACGACGTCTGCGGCCACCCTTCGATGCACGTCCTCGGCGTCTCCAACCCC
TCGAACCCGGAAGCCGCCGACCCGTCCTGGGTGCGCGCGACCACCACGCCCTCCTCGAGACGCCCGACCATCACC
TGCGCCAAGGCGTCCAGCGTTCAGCTCATCCTCTACGATCGGCCCCGCCCCAAGCGTATGCAGTACATATCGCTC
GACCCCATCGCCTTGGCTCTCGGCGACAAGGGCTCTGCGCTCGAGGATACGCGGGTCGCCGGCCCTGAAGGCGAA
ATCGAAGAGCAGGAGCTCAAGGCCAAGGAGGCGCGGCGCAAGCTGGTGGAGAAGCTCAAGCTACACACAATCACC
CACCGTGTGCCCTCCGCCCGGGACAGGGCGTTGCCCAAGATCGTTAATCAGGTCAACTGGTCGTGGGAGCTGGAG
CAGACGCTGCAAAAGAATGTCGGGCGCCTCGGCCCGCGACCGAGGCGCGGCCTCAGCGTGTCGGAAAGGATGGTC
GAGTCGGCCACAACCATGAGGAACTACGTTCTGCACCGGCTCTGGGCCTGGTCCACACTGTATTTGTTCCCGGTC
CTGTGGCGGGGATTCTGTCTGCTTCTCTTCGGCCACCGAATGGTAGCCGAGGTGCTACTCTTCGCTCTCGAGTTC
CGGCCCAAACCGGGTGGCGCCGCTCTCAAAGACATCTCGGCGACGGCCCAGCAGATCGAGATTCGCCTTCAGCAG
TTTTGCTACTGGCCCATGCAGTATTCGACGTTGCGCCGGCGCAAGATGAACTGGTCAAGCGTCACCACCAGCCAT
CCCGACTACATCCGCTTCTACAACAGCCTGTGGCTCGTTGCCAACGACGTCATCATCGGCATGGCCCTGGGCTCG
TACATCATCGAACACGCCGACTGGGTGGCGGCCCAGATCGGCGACCTCCTGCGGACCTACGCCGTCGAGGCCCTC
CGGCGGAGCATTTCCTGGCTCATGGGCTGGCCGGCCGGCCTCAAACTCAACGGCGAACTGGCGGCCTTCTTGGGG
GACCTGTTCCTCTGGGTCATCCACTATTGGTCAAGTGAGTCCTGCGCATATAGAGTCGGCACGTCGTGCCCGGTG
TCGGAGTGGGCCAGGCTAACACTCCGGCAGCATGCATCGAGGCGTTACAGCCGGTGCTGCCGCGCCTGGTGTGGT
TCATCGGCTTCTCGTCCTTCGCCGGGGCCAGCATGCCCATCGCCGTCTTCTCCGACCTCCTGTCCGCCCTGACCA
TCCACATCTACTCGTTCTACCTGGCCTCGGCCCGCATCTACCACTGGCAGCTCACGATCCTGCAGTCGCTGTTCC
ACCTGTTCCGCGGCAAGAAACACAACGTGCTTCGCAACCGTATCGACTCGTGCGACTACGACCTGGATCAGCTGC
TCGTCGGCACCATCTTCTTCACCCTGCTGTCCTTCCTGCTGCCCACCGTCGTCGTCTTCTACCTGAACTTTGCGA
TTGCGAGGATGATCATCATCTCGATGAAGGCCGGCTTCGACACGCTCCTCTCCTGCCTGAACCACTTCCCGCTGT
TCGCCCTGATGCTGAGGGTCAAGGACCCCCGACGGCTGCCCGGTAAGGTCGAAGGGAGTCGAGAGGGCGCGTGCT
ACGCCGCTGGAGGACACACGGGCACTGACTCGGTCGCCGCACAGGTGGCATTCGCTTCGAGCTCCGAGACAGCCA
GGGCCAGAGGGCCTCGGCCACCACTGGTCTCTACAAGGAGCCGCCGACGTCGGTCATCTACCTCAAAGTCAGTAT
ACCCCACCCCGTCGACGTCTTGCCGAGCCGGGCGCCCCCGACTGACGGACGAACGGTGACAGTCGATCCCGCTGT
CCTTTAGCGCCATGTTCCACCAGTACTTCCAGATGGCGCAGCGGATCCGGAAGCACTACCTGTCTCCGGGCGTGC
TGCTCCGGCTGCTGACGGGCCAGTTCGTGCCGCCAATCAACCGGAAGAACCTGTACAGCCTGCAGTACAGCATGC
TGCCGGCGAAGCGGGCGACGGCGTGGGAGATGTGGCGAGCCCTCAATATGGAGCTGCCGCAGAAAAAGTCGTTCT
ACCTGCCGCCGATCCCGTCGCTGTCAAACGGGAGCAAGCGGGCCGCCGGCAACGGGCGGGCCAGGTCTCACCACT
GA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail