Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8659
Gene name
LocationContig_58:12453..16266
Strand+
Gene length (bp)3813
Transcript length (bp)3813
Coding sequence length (bp)3813
Protein length (aa) 1271

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 2.3E-37 998 1240
PF00187 Chitin_bind_1 Chitin recognition protein 8.2E-08 495 529
PF05922 Inhibitor_I9 Peptidase inhibitor I9 3.1E-05 877 917

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29118|ALP_ACRCH Alkaline proteinase OS=Acremonium chrysogenum GN=ALP PE=3 SV=1 836 1258 2.0E-62
sp|A1CIA7|ORYZ_ASPCL Alkaline protease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alp1 PE=3 SV=1 886 1258 2.0E-60
sp|Q9Y778|SMP1_MAGPO Subtilisin-like proteinase Mp1 OS=Magnaporthiopsis poae PE=1 SV=1 885 1250 1.0E-59
sp|A1CWF3|ORYZ_NEOFI Alkaline protease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alp1 PE=2 SV=1 886 1258 3.0E-59
sp|Q03420|ALP_HYPAT Alkaline proteinase OS=Hypocrea atroviridis GN=prb1 PE=1 SV=1 884 1258 7.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29118|ALP_ACRCH Alkaline proteinase OS=Acremonium chrysogenum GN=ALP PE=3 SV=1 836 1258 2.0E-62
sp|A1CIA7|ORYZ_ASPCL Alkaline protease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alp1 PE=3 SV=1 886 1258 2.0E-60
sp|Q9Y778|SMP1_MAGPO Subtilisin-like proteinase Mp1 OS=Magnaporthiopsis poae PE=1 SV=1 885 1250 1.0E-59
sp|A1CWF3|ORYZ_NEOFI Alkaline protease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alp1 PE=2 SV=1 886 1258 3.0E-59
sp|Q03420|ALP_HYPAT Alkaline proteinase OS=Hypocrea atroviridis GN=prb1 PE=1 SV=1 884 1258 7.0E-59
sp|P28296|ORYZ_ASPFU Alkaline protease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp1 PE=1 SV=2 886 1258 7.0E-58
sp|B0Y708|ORYZ_ASPFC Alkaline protease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp1 PE=3 SV=1 886 1258 7.0E-58
sp|P12547|ORYZ_ASPOR Alkaline protease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alp1 PE=1 SV=2 886 1258 3.0E-57
sp|B8N106|ORYZ_ASPFN Alkaline protease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=alp1 PE=1 SV=1 886 1258 3.0E-57
sp|P35211|ORYZ_ASPFL Alkaline protease 1 OS=Aspergillus flavus GN=alp1 PE=1 SV=1 886 1258 8.0E-55
sp|Q00208|ORYZ_EMENI Alkaline protease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alp1 PE=2 SV=1 886 1255 5.0E-54
sp|C5NZ70|SUB2C_COCP7 Subtilisin-like protease CPC735_013710 OS=Coccidioides posadasii (strain C735) GN=CPC735_013710 PE=3 SV=1 956 1255 2.0E-50
sp|E4UPZ4|SUB1_ARTGP Subtilisin-like protease 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB1 PE=3 SV=1 836 1259 6.0E-50
sp|D4AZ75|SUB2_ARTBC Subtilisin-like protease 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB2 PE=2 SV=2 956 1255 1.0E-48
sp|Q64K35|SUB2_ARTBE Subtilisin-like protease 2 OS=Arthroderma benhamiae GN=SUB2 PE=3 SV=2 956 1255 1.0E-48
sp|D4DLI5|SUB2_TRIVH Subtilisin-like protease 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB2 PE=3 SV=2 956 1255 3.0E-48
sp|P29138|CUDP_METAN Cuticle-degrading protease OS=Metarhizium anisopliae GN=PR1 PE=1 SV=1 884 1255 3.0E-48
sp|Q5VJ76|SUB2_TRIVC Subtilisin-like protease 2 OS=Trichophyton verrucosum GN=SUB2 PE=3 SV=2 956 1255 3.0E-48
sp|C5P906|SUB2B_COCP7 Subtilisin-like protease CPC735_003880 OS=Coccidioides posadasii (strain C735) GN=CPC735_003880 PE=3 SV=1 956 1261 6.0E-48
sp|E4UZP9|SUB2_ARTGP Subtilisin-like protease 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB2 PE=3 SV=1 956 1219 6.0E-48
sp|Q69F58|SUB1_TRIRU Subtilisin-like protease 1 OS=Trichophyton rubrum GN=SUB1 PE=2 SV=1 836 1259 8.0E-48
sp|C5G168|SUB2_ARTOC Subtilisin-like protease 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB2 PE=3 SV=1 956 1255 9.0E-48
sp|C5NZ69|SUB7C_COCP7 Subtilisin-like protease CPC735_013700 OS=Coccidioides posadasii (strain C735) GN=CPC735_013700 PE=3 SV=1 844 1256 3.0E-47
sp|B6VA85|SUB2_TRIEQ Subtilisin-like protease 2 OS=Trichophyton equinum GN=SUB2 PE=3 SV=1 956 1255 3.0E-47
sp|Q9UTS0|PSP3_SCHPO Subtilase-type proteinase psp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psp3 PE=2 SV=1 869 1256 6.0E-47
sp|B8XGQ5|SUB2_TRITO Subtilisin-like protease 2 OS=Trichophyton tonsurans GN=SUB2 PE=3 SV=2 956 1255 7.0E-47
sp|D4DIW9|SUB1_TRIVH Subtilisin-like protease 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB1 PE=3 SV=1 836 1259 7.0E-47
sp|D4AKU9|SUB1_ARTBC Subtilisin-like protease 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB1 PE=2 SV=2 836 1259 8.0E-47
sp|L8GD75|SUB3_PSED2 Subtilisin-like protease 3 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP3 PE=3 SV=1 869 1267 8.0E-47
sp|Q69F57|SUB2_TRIRU Subtilisin-like protease 2 OS=Trichophyton rubrum GN=SUB2 PE=3 SV=2 956 1255 1.0E-46
sp|Q5VJ77|SUB1_TRIVC Subtilisin-like protease 1 (Fragment) OS=Trichophyton verrucosum GN=SUB1 PE=3 SV=1 836 1258 2.0E-46
sp|Q64K30|SUB1_ARTBE Subtilisin-like protease 1 (Fragment) OS=Arthroderma benhamiae GN=SUB1 PE=3 SV=1 836 1258 2.0E-46
sp|C5PCX1|SUB7B_COCP7 Subtilisin-like protease CPC735_015300 OS=Coccidioides posadasii (strain C735) GN=CPC735_015300 PE=3 SV=1 863 1259 3.0E-46
sp|B6VA84|SUB1_TRIEQ Subtilisin-like protease 1 OS=Trichophyton equinum GN=SUB1 PE=3 SV=1 836 1259 9.0E-46
sp|B8XGQ4|SUB1_TRITO Subtilisin-like protease 1 OS=Trichophyton tonsurans GN=SUB1 PE=3 SV=1 836 1259 1.0E-45
sp|C5PCB1|SUB4A_COCP7 Subtilisin-like protease CPC735_066880 OS=Coccidioides posadasii (strain C735) GN=CPC735_066880 PE=3 SV=1 885 1255 4.0E-45
sp|C5P6D1|SUB2A_COCP7 Subtilisin-like protease CPC735_023170 OS=Coccidioides posadasii (strain C735) GN=CPC735_023170 PE=3 SV=1 884 1259 9.0E-45
sp|P40903|ISP6_SCHPO Sexual differentiation process putative subtilase-type proteinase isp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp6 PE=2 SV=1 872 1221 9.0E-45
sp|C5FJA5|SUB7_ARTOC Subtilisin-like protease 7 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB7 PE=3 SV=1 876 1259 2.0E-44
sp|L8G6I7|SUB1_PSED2 Subtilisin-like protease 1 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP1 PE=1 SV=1 836 1258 2.0E-44
sp|C5FPS1|SUB1_ARTOC Subtilisin-like protease 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB1 PE=3 SV=1 830 1260 2.0E-44
sp|Q8J0D9|SUB1_ARTOT Subtilisin-like protease 1 OS=Arthroderma otae GN=SUB1 PE=3 SV=1 830 1260 3.0E-44
sp|C5G1D1|SUB5_ARTOC Subtilisin-like protease 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB5 PE=3 SV=1 844 1223 5.0E-44
sp|Q8J0D8|SUB2_ARTOT Subtilisin-like protease 2 OS=Arthroderma otae GN=SUB2 PE=3 SV=2 956 1255 5.0E-44
sp|P09232|PRTB_YEAST Cerevisin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRB1 PE=1 SV=1 886 1220 6.0E-44
sp|Q8NID9|SUB7_TRIRU Subtilisin-like protease 7 OS=Trichophyton rubrum GN=SUB7 PE=2 SV=1 885 1258 7.0E-44
sp|A1XIH5|SUB7_TRISD Subtilisin-like protease 7 OS=Trichophyton soudanense GN=SUB7 PE=1 SV=1 885 1258 2.0E-43
sp|Q5VJ71|SUB7_TRIVC Subtilisin-like protease 7 OS=Trichophyton verrucosum GN=SUB7 PE=3 SV=1 885 1258 3.0E-43
sp|A1XIH6|SUB7_TRIVO Subtilisin-like protease 7 OS=Trichophyton violaceum GN=SUB7 PE=1 SV=1 885 1258 5.0E-43
sp|Q64K36|SUB7_ARTBE Subtilisin-like protease 7 OS=Arthroderma benhamiae GN=SUB7 PE=1 SV=1 885 1258 5.0E-43
sp|E4UN97|SUB3_ARTGP Subtilisin-like protease 3 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB3 PE=3 SV=1 877 1259 9.0E-43
sp|P06873|PRTK_ENGAL Proteinase K OS=Engyodontium album GN=PROK PE=1 SV=2 886 1256 1.0E-42
sp|A1XIH3|SUB7_TRIEQ Subtilisin-like protease 7 OS=Trichophyton equinum GN=SUB7 PE=1 SV=1 885 1258 3.0E-42
sp|L8FSM5|SUB2_PSED2 Subtilisin-like protease 2 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP2 PE=3 SV=1 836 1258 3.0E-42
sp|A1XIH4|SUB7_TRITO Subtilisin-like protease 7 OS=Trichophyton tonsurans GN=SUB7 PE=1 SV=1 885 1258 5.0E-42
sp|Q8J0D7|SUB3_ARTOT Subtilisin-like protease 3 OS=Arthroderma otae GN=SUB3 PE=1 SV=1 875 1259 7.0E-42
sp|C5FMY5|SUB3_ARTOC Subtilisin-like protease 3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB3 PE=3 SV=1 875 1259 7.0E-42
sp|C5P4Z8|SUB8_COCP7 Subtilisin-like protease CPC735_031240 OS=Coccidioides posadasii (strain C735) GN=CPC735_031240 PE=3 SV=1 888 1261 7.0E-42
sp|D4CZQ4|SUB7_TRIVH Subtilisin-like protease 7 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB7 PE=3 SV=2 885 1258 9.0E-42
sp|C5PGK9|SUB7A_COCP7 Subtilisin-like protease CPC735_050320 OS=Coccidioides posadasii (strain C735) GN=CPC735_050320 PE=3 SV=1 835 1255 2.0E-41
sp|D4APA9|SUB7_ARTBC Subtilisin-like protease 7 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB7 PE=1 SV=2 885 1258 2.0E-41
sp|B8XGQ6|SUB3_TRITO Subtilisin-like protease 3 OS=Trichophyton tonsurans GN=SUB3 PE=3 SV=1 875 1223 3.0E-41
sp|P87184|ALP2_ASPFU Alkaline protease 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp2 PE=1 SV=1 888 1261 3.0E-41
sp|B0Y473|ALP2_ASPFC Alkaline protease 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp2 PE=3 SV=1 888 1261 3.0E-41
sp|P23653|PRTR_ENGAL Proteinase R OS=Engyodontium album GN=PROR PE=1 SV=1 886 1256 3.0E-41
sp|B6VA86|SUB3_TRIEQ Subtilisin-like protease 3 OS=Trichophyton equinum GN=SUB3 PE=3 SV=1 875 1223 1.0E-40
sp|D4DLA2|SUB3_TRIVH Subtilisin-like protease 3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB3 PE=3 SV=1 875 1259 2.0E-40
sp|Q5VJ75|SUB3_TRIVC Subtilisin-like protease 3 OS=Trichophyton verrucosum GN=SUB3 PE=3 SV=1 875 1259 2.0E-40
sp|Q64K34|SUB3_ARTBE Subtilisin-like protease 3 OS=Arthroderma benhamiae GN=SUB3 PE=1 SV=1 875 1259 2.0E-40
sp|D4AWY5|SUB3_ARTBC Subtilisin-like protease 3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB3 PE=1 SV=1 875 1259 2.0E-40
sp|Q69F56|SUB3_TRIRU Subtilisin-like protease 3 OS=Trichophyton rubrum GN=SUB3 PE=1 SV=1 875 1259 5.0E-40
sp|C5P1W9|SU11A_COCP7 Subtilisin-like protease CPC735_035780 OS=Coccidioides posadasii (strain C735) GN=CPC735_035780 PE=3 SV=1 878 1259 1.0E-39
sp|E4V2V9|SUB7_ARTGP Subtilisin-like protease 7 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB7 PE=3 SV=1 885 1259 2.0E-39
sp|C5P5Q3|SUB9_COCP7 Subtilisin-like protease CPC735_033790 OS=Coccidioides posadasii (strain C735) GN=CPC735_033790 PE=3 SV=1 885 1258 3.0E-39
sp|P80146|SEPR_THESR Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 954 1262 3.0E-39
sp|P25036|YSP3_YEAST Subtilisin-like protease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP3 PE=2 SV=2 886 1220 4.0E-39
sp|Q5VJ72|SUB6_TRIVC Subtilisin-like protease 6 OS=Trichophyton verrucosum GN=SUB6 PE=3 SV=1 886 1220 5.0E-39
sp|P09230|AEP_YARLI Alkaline extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR2 PE=1 SV=1 885 1255 5.0E-39
sp|D4B194|SUB5_ARTBC Subtilisin-like protease 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB5 PE=3 SV=1 844 1226 5.0E-39
sp|D4DIS6|SUB10_TRIVH Subtilisin-like protease 10 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB10 PE=3 SV=1 851 1222 6.0E-39
sp|E4V2L6|SUB5_ARTGP Subtilisin-like protease 5 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB5 PE=3 SV=1 859 1226 7.0E-39
sp|D4DKQ4|SUB8_TRIVH Subtilisin-like protease 8 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB8 PE=3 SV=1 885 1255 9.0E-39
sp|G1X8P8|SPAZ_ARTOA Cuticle-degrading serine protease OS=Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) PE=1 SV=1 875 1258 1.0E-38
sp|D4AX50|SUB8_ARTBC Subtilisin-like protease 8 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB8 PE=3 SV=1 885 1255 2.0E-38
sp|C5PFR5|SU11B_COCP7 Subtilisin-like protease CPC735_047380 OS=Coccidioides posadasii (strain C735) GN=CPC735_047380 PE=3 SV=1 878 1226 4.0E-38
sp|P20015|PRTT_ENGAL Proteinase T (Fragment) OS=Engyodontium album GN=PROT PE=1 SV=1 955 1255 5.0E-38
sp|P58371|SPM1_MAGO7 Subtilisin-like proteinase Spm1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPM1 PE=3 SV=1 885 1261 7.0E-38
sp|P33295|PEPC_ASPNG Subtilisin-like serine protease pepC OS=Aspergillus niger GN=pepC PE=3 SV=1 888 1265 1.0E-37
sp|C5FQI3|SUB6_ARTOC Subtilisin-like protease 6 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB6 PE=3 SV=1 889 1259 2.0E-37
sp|C5FII2|SUB8_ARTOC Subtilisin-like protease 8 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB8 PE=3 SV=1 885 1261 2.0E-37
sp|D4D5H3|SUB6_TRIVH Subtilisin-like protease 6 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB6 PE=3 SV=1 886 1220 2.0E-37
sp|C5P6L5|SUB4C_COCP7 Subtilisin-like protease CPC735_024010 OS=Coccidioides posadasii (strain C735) GN=CPC735_024010 PE=3 SV=1 844 1223 2.0E-37
sp|Q68GV9|ALP_LECPS Alkaline serine protease ver112 OS=Lecanicillium psalliotae PE=1 SV=1 886 1255 6.0E-37
sp|D4AQG0|SUB10_ARTBC Subtilisin-like protease 10 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB10 PE=3 SV=2 851 1267 1.0E-36
sp|E4V4J8|SUB6_ARTGP Subtilisin-like protease 6 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB6 PE=3 SV=1 877 1259 1.0E-36
sp|A7UKV6|SUB4_TRIEQ Subtilisin-like protease 4 (Fragment) OS=Trichophyton equinum GN=SUB4 PE=3 SV=1 886 1226 3.0E-36
sp|D4D6Q4|SUB4_TRIVH Subtilisin-like protease 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB4 PE=3 SV=1 886 1226 3.0E-36
sp|Q5VJ74|SUB4_TRIVC Subtilisin-like protease 4 OS=Trichophyton verrucosum GN=SUB4 PE=3 SV=1 886 1226 3.0E-36
sp|Q64K33|SUB4_ARTBE Subtilisin-like protease 4 OS=Arthroderma benhamiae GN=SUB4 PE=3 SV=1 886 1226 3.0E-36
sp|D4AXW3|SUB4_ARTBC Subtilisin-like protease 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB4 PE=1 SV=2 886 1226 3.0E-36
sp|C5FXZ6|SUB4_ARTOC Subtilisin-like protease 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB4 PE=3 SV=1 886 1220 3.0E-36
sp|B8XGQ7|SUB4_TRITO Subtilisin-like protease 4 OS=Trichophyton tonsurans GN=SUB4 PE=3 SV=1 886 1226 4.0E-36
sp|Q69F35|SUB4_TRIRU Subtilisin-like protease 4 OS=Trichophyton rubrum GN=SUB4 PE=1 SV=1 886 1220 8.0E-36
sp|C5FH27|SUB9_ARTOC Subtilisin-like protease 9 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB9 PE=3 SV=1 884 1235 1.0E-35
sp|D4B5N1|SUB9_ARTBC Subtilisin-like protease 9 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB9 PE=3 SV=1 882 1240 4.0E-35
sp|A1XIH1|SUB6_TRISD Subtilisin-like protease 6 OS=Trichophyton soudanense GN=SUB6 PE=1 SV=1 886 1259 7.0E-35
sp|Q9UW97|SUB6_TRIRU Subtilisin-like protease 6 OS=Trichophyton rubrum GN=SUB6 PE=1 SV=1 886 1259 7.0E-35
sp|C5NZT2|SUB4B_COCP7 Subtilisin-like protease CPC735_012930 OS=Coccidioides posadasii (strain C735) GN=CPC735_012930 PE=3 SV=1 834 1225 2.0E-34
sp|Q3ZEJ8|SUB6_TRITO Subtilisin-like protease 6 OS=Trichophyton tonsurans GN=SUB6 PE=3 SV=1 886 1220 3.0E-34
sp|E4UWA4|SUB4_ARTGP Subtilisin-like protease 4 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB4 PE=3 SV=1 886 1259 3.0E-34
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 858 1220 3.0E-34
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 858 1220 3.0E-34
sp|A1XIH0|SUB6_TRIEQ Subtilisin-like protease 6 OS=Trichophyton equinum GN=SUB6 PE=1 SV=1 886 1220 4.0E-34
sp|E4UTU7|SUB9_ARTGP Subtilisin-like protease 9 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB9 PE=3 SV=1 885 1240 5.0E-34
sp|E4UY04|SUB12_ARTGP Subtilisin-like protease 12 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB12 PE=3 SV=1 834 1258 9.0E-34
sp|P25381|RRT12_YEAST Subtilase-type proteinase RRT12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRT12 PE=1 SV=1 957 1230 2.0E-33
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 886 1220 4.0E-33
sp|P08594|AQL1_THEAQ Aqualysin-1 OS=Thermus aquaticus GN=pstI PE=1 SV=2 834 1251 8.0E-33
sp|Q69F34|SUB5_TRIRU Subtilisin-like protease 5 OS=Trichophyton rubrum GN=SUB5 PE=2 SV=1 859 1226 1.0E-32
sp|D4D0F5|SUB5_TRIVH Subtilisin-like protease 5 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB5 PE=3 SV=1 859 1226 1.0E-32
sp|Q5VJ73|SUB5_TRIVC Subtilisin-like protease 5 OS=Trichophyton verrucosum GN=SUB5 PE=3 SV=1 859 1226 1.0E-32
sp|Q64K32|SUB5_ARTBE Subtilisin-like protease 5 OS=Arthroderma benhamiae GN=SUB5 PE=3 SV=1 859 1226 1.0E-32
sp|D4APE3|SUB11_ARTBC Subtilisin-like protease 11 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB11 PE=3 SV=1 882 1259 2.0E-32
sp|G3FNQ9|SPAZ_ARTOL Cuticle-degrading serine protease OS=Arthrobotrys oligospora PE=1 SV=2 875 1219 3.0E-32
sp|D4CZ60|SUB11_TRIVH Subtilisin-like protease 11 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB11 PE=3 SV=1 844 1259 3.0E-32
sp|B8XGQ8|SUB5_TRITO Subtilisin-like protease 5 OS=Trichophyton tonsurans GN=SUB5 PE=3 SV=1 859 1226 4.0E-32
sp|B6VA87|SUB5_TRIEQ Subtilisin-like protease 5 OS=Trichophyton equinum GN=SUB5 PE=3 SV=1 859 1226 4.0E-32
sp|D4D674|SUB9_TRIVH Subtilisin-like protease 9 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB9 PE=3 SV=1 882 1258 5.0E-32
sp|P16588|PROA_VIBAL Alkaline serine exoprotease A OS=Vibrio alginolyticus GN=proA PE=3 SV=1 884 1252 5.0E-32
sp|D4D1U5|SUB12_TRIVH Subtilisin-like protease 12 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB12 PE=3 SV=1 885 1258 7.0E-32
sp|E4V5C5|SUB11_ARTGP Subtilisin-like protease 11 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB11 PE=3 SV=1 882 1259 7.0E-32
sp|C5FX37|SUB10_ARTOC Subtilisin-like protease 10 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB10 PE=3 SV=1 954 1259 6.0E-30
sp|C5P9H3|SUB7D_COCP7 Subtilisin-like protease CPC735_005570 OS=Coccidioides posadasii (strain C735) GN=CPC735_005570 PE=3 SV=1 882 1226 3.0E-29
sp|D4AQA9|SUB12_ARTBC Subtilisin-like protease 12 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB12 PE=3 SV=1 834 1223 2.0E-28
sp|C5FZ39|SUB11_ARTOC Subtilisin-like protease 11 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB11 PE=3 SV=1 878 1259 3.0E-28
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 998 1243 6.0E-22
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 991 1237 2.0E-21
sp|Q8SQJ3|SPL1_ENCCU Putative subtilisin-like proteinase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPL1 PE=2 SV=1 954 1236 7.0E-20
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 965 1255 1.0E-19
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 965 1255 2.0E-19
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 965 1219 1.0E-18
sp|Q5JIZ5|TKSP_THEKO Subtilisin-like serine protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1689 PE=1 SV=1 1029 1236 1.0E-18
sp|P41363|ELYA_BACHD Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 986 1237 2.0E-18
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 965 1255 1.0E-17
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 965 1255 1.0E-17
sp|Q80W65|PCSK9_MOUSE Proprotein convertase subtilisin/kexin type 9 OS=Mus musculus GN=Pcsk9 PE=1 SV=2 823 1241 3.0E-17
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 1040 1248 3.0E-17
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 993 1209 5.0E-17
sp|A8T655|PCSK9_PANPA Proprotein convertase subtilisin/kexin type 9 OS=Pan paniscus GN=PCSK9 PE=2 SV=2 824 1197 7.0E-17
sp|O31788|APRX_BACSU Serine protease AprX OS=Bacillus subtilis (strain 168) GN=aprX PE=1 SV=1 988 1240 9.0E-17
sp|A8T644|PCSK9_PANTR Proprotein convertase subtilisin/kexin type 9 OS=Pan troglodytes GN=PCSK9 PE=2 SV=1 844 1197 1.0E-16
sp|A8T650|PCSK9_GORGO Proprotein convertase subtilisin/kexin type 9 OS=Gorilla gorilla gorilla GN=PCSK9 PE=2 SV=1 844 1197 2.0E-16
sp|Q8NBP7|PCSK9_HUMAN Proprotein convertase subtilisin/kexin type 9 OS=Homo sapiens GN=PCSK9 PE=1 SV=3 844 1197 2.0E-16
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 985 1215 2.0E-16
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 952 1237 3.0E-16
sp|A8T658|PCSK9_PONPY Proprotein convertase subtilisin/kexin type 9 OS=Pongo pygmaeus GN=PCSK9 PE=2 SV=1 870 1197 3.0E-16
sp|A8T6A1|PCSK9_ATEGE Proprotein convertase subtilisin/kexin type 9 OS=Ateles geoffroyi GN=PCSK9 PE=2 SV=1 872 1197 3.0E-16
sp|A8T688|PCSK9_CALJA Proprotein convertase subtilisin/kexin type 9 OS=Callithrix jacchus GN=PCSK9 PE=2 SV=1 961 1197 5.0E-16
sp|A8T695|PCSK9_SAIBB Proprotein convertase subtilisin/kexin type 9 OS=Saimiri boliviensis boliviensis GN=PCSK9 PE=2 SV=1 872 1197 5.0E-16
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 1040 1236 7.0E-16
sp|A8T672|PCSK9_COLGU Proprotein convertase subtilisin/kexin type 9 OS=Colobus guereza GN=PCSK9 PE=2 SV=1 861 1197 7.0E-16
sp|A8T666|PCSK9_MACMU Proprotein convertase subtilisin/kexin type 9 OS=Macaca mulatta GN=PCSK9 PE=2 SV=1 861 1197 7.0E-16
sp|A8T662|PCSK9_MACNE Proprotein convertase subtilisin/kexin type 9 OS=Macaca nemestrina GN=PCSK9 PE=2 SV=1 861 1197 8.0E-16
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 986 1214 8.0E-16
sp|P59996|PCSK9_RAT Proprotein convertase subtilisin/kexin type 9 OS=Rattus norvegicus GN=Pcsk9 PE=1 SV=1 823 1241 1.0E-15
sp|A8T6A6|PCSK9_LAGLA Proprotein convertase subtilisin/kexin type 9 OS=Lagothrix lagotricha GN=PCSK9 PE=2 SV=1 844 1197 1.0E-15
sp|A8T677|PCSK9_CALMO Proprotein convertase subtilisin/kexin type 9 OS=Callicebus moloch GN=PCSK9 PE=2 SV=1 861 1197 3.0E-15
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 959 1243 3.0E-15
sp|A8T682|PCSK9_SAGLB Proprotein convertase subtilisin/kexin type 9 OS=Saguinus labiatus GN=PCSK9 PE=2 SV=1 872 1197 5.0E-15
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 976 1218 7.0E-15
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 986 1266 1.0E-14
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 1040 1219 2.0E-14
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 986 1214 3.0E-14
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 986 1214 4.0E-14
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 986 1214 5.0E-14
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 987 1215 5.0E-14
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 1040 1219 6.0E-14
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 965 1219 8.0E-14
sp|P29143|HLY_NATA1 Halolysin OS=Natrialba asiatica (strain ATCC 700177 / DSM 12278 / JCM 9576 / FERM P-10747 / NBRC 102637 / 172P1) GN=hly PE=1 SV=1 998 1247 5.0E-13
sp|Q5RLZ1|NEP_NATMA Halolysin-like extracellular serine protease Nep OS=Natrialba magadii GN=nep PE=1 SV=2 1040 1247 1.0E-12
sp|P29140|ISP_BACCS Intracellular alkaline protease OS=Bacillus clausii PE=3 SV=1 998 1235 4.0E-12
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 1026 1266 3.0E-10
sp|Q9WTZ2|MBTP1_MOUSE Membrane-bound transcription factor site-1 protease OS=Mus musculus GN=Mbtps1 PE=1 SV=1 991 1238 6.0E-08
sp|Q9Z2A8|MBTP1_CRIGR Membrane-bound transcription factor site-1 protease OS=Cricetulus griseus GN=MBTPS1 PE=1 SV=2 991 1238 8.0E-08
sp|P28842|SUBT_BACS9 Subtilisin OS=Bacillus sp. (strain TA39) GN=sub1 PE=1 SV=1 998 1214 8.0E-08
sp|Q9WTZ3|MBTP1_RAT Membrane-bound transcription factor site-1 protease OS=Rattus norvegicus GN=Mbtps1 PE=1 SV=2 991 1238 8.0E-08
sp|Q14703|MBTP1_HUMAN Membrane-bound transcription factor site-1 protease OS=Homo sapiens GN=MBTPS1 PE=1 SV=1 990 1238 2.0E-07
sp|Q07596|NISP_LACLL Nisin leader peptide-processing serine protease NisP OS=Lactococcus lactis subsp. lactis GN=nisP PE=1 SV=1 1030 1233 4.0E-06
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 991 1139 5.0E-06
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 991 1139 7.0E-06
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 991 1139 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0008061 chitin binding Yes
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0019538 protein metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0017171 serine hydrolase activity No
GO:0044238 primary metabolic process No
GO:0008233 peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.3825 0.3035 0.8599 0.1272 0.1324 0.0749 0.0583 0.0792 0.0483 0.0361

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup46
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3126
Ophiocordyceps australis 1348a (Ghana) OphauG2|3121
Ophiocordyceps australis 1348a (Ghana) OphauG2|2885
Ophiocordyceps australis 1348a (Ghana) OphauG2|1445
Ophiocordyceps australis map64 (Brazil) OphauB2|2218
Ophiocordyceps australis map64 (Brazil) OphauB2|70
Ophiocordyceps australis map64 (Brazil) OphauB2|4868
Ophiocordyceps australis map64 (Brazil) OphauB2|3986
Ophiocordyceps australis map64 (Brazil) OphauB2|1469
Ophiocordyceps australis map64 (Brazil) OphauB2|3181
Ophiocordyceps camponoti-floridani Ophcf2|02561
Ophiocordyceps camponoti-rufipedis Ophun1|3584
Ophiocordyceps kimflemingae Ophio5|993
Ophiocordyceps subramaniannii Hirsu2|8659 (this protein)
Ophiocordyceps subramaniannii Hirsu2|833
Ophiocordyceps subramaniannii Hirsu2|8284
Ophiocordyceps subramaniannii Hirsu2|6950
Ophiocordyceps subramaniannii Hirsu2|523
Ophiocordyceps subramaniannii Hirsu2|5200
Ophiocordyceps subramaniannii Hirsu2|1578
Ophiocordyceps subramaniannii Hirsu2|1378
Ophiocordyceps subramaniannii Hirsu2|11137

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8659
MPLREDGALTPSANVADEYMPFLFTPPSGDATGIDKLSYFAPPESNTEVKSVPDRDGAGKDAAIQVASRDQPGAD
LTARSLDQSRCSSLSITADSILTKDYQSYLTALDVSASATVSGWGQSASISGHYLDQARLSDSDLTYVAIIEIQR
QQISNDVFKFNDDLYNSLSFTENFGDRWIRGFQSGGKLIARVSIKTHEGAKKAEVEAHAKASLAFWGISGDFSAT
VKNSMKRLDQHAGVHISIHYQGVLGREMLKSAPENIAVGSAEGSFGQAKLWADRFIERACDHDYPYAALLDSYKT
LENFPANQEVVDYRAAKSEAKFLLQDLVKLSEMTTLLRTYDLSDAVKYEIDRAEAHLIEASRTWVENTAIDPSRA
EESREILRASFNTTFYAPYRKYLEKRVALYERPNFEGKSIAVTTPTGKCVDVPMSFNDVAASFRLEMTAACRFHT
DFGCRGSFFLAWEDEDNLPSDRPEFSDAISSLSCSPSQAREQNERCGPDGGHHVCAQGLCCSKHGYCGLTDAHCV
SCQEGFGICSSQPQFDDISRHVQSWWERGEQETDRSDQCRQQCHQPSTWGKELEPFCRLRCDEEEKLTQKEGSAI
EDHIRQWGTRGAQQFDICRQDCDRLADKNGRWRRTRAPFCRQQCDNEQKDQESKAIDRHIEYWAGPGGQEFGKCQ
KDCNQLAGLAGKWRNERVPYCIHRCRLEYYRMIQDFALRGELEFHKADDRLERRISMMRQSLEISRQTAARGRLP
EIKLGLFKDIEEFDRFFDDFFREIRQEAQAIDEFIKSWPGSEKQQFDECRQGCDRLAGQTGRWRKKRVPFCQRRC
HHEEAKAGGGHIVMLNTGPNDYMYHLELHIGLLQDRYQHKVVVETSLFNVTHKFLAETHGFHGYAGKFSQDIIAY
IAELDDVAFVEEDTIMSIPPPIVESESEPAVEEAVDETNGLERRQGTRVLPLTFATQDHAPWNLYAISQRHPPPK
LKPNCFFKYYHNSLAGENTYAYVIDTGVLYTHQQFEGRAEHGCTVKYGVQGCSTSPSDATDTLGHGTHVAGIIAS
KTYGVAKKAKVISVKVFDENGNSPKSATIDAFAWAVHDIRVKGRRDKAVINISAGGGQSDIQNAAINSAFEALGI
ITVVSAGNDGRPASEKSPASADKAITVGSMRRDWSVDPDSNFGPEVDILAPGQAIVSLSNRHDGAFTTRFGTVAM
SGSSMATPHVAGLALYAMSVYGIKADGIKQFLIDTATKSKITGHLQGTENRLANNNNAKQNLHHSEDPCI*
Coding >Hirsu2|8659
ATGCCGCTTCGCGAAGATGGCGCATTAACACCTAGTGCAAATGTGGCCGACGAATATATGCCTTTTCTGTTTACG
CCACCTAGCGGAGATGCGACTGGCATAGACAAACTGTCATACTTTGCACCACCTGAGTCGAACACGGAGGTAAAA
TCAGTGCCTGACCGGGACGGCGCTGGAAAAGACGCGGCTATTCAGGTGGCTAGCCGTGATCAACCTGGCGCTGAC
TTGACTGCTCGATCGCTTGACCAAAGCAGATGCTCTTCCCTTAGTATCACGGCAGACTCCATACTCACGAAAGAT
TACCAGTCTTATTTGACGGCCCTTGACGTGAGTGCTTCCGCGACCGTATCTGGTTGGGGCCAGAGCGCATCTATA
TCAGGTCATTATCTGGACCAGGCAAGGCTGTCCGATAGCGACTTGACATACGTGGCCATAATCGAAATCCAGAGA
CAGCAAATTTCGAACGACGTATTCAAATTCAATGACGATCTCTATAACAGTTTAAGTTTCACCGAGAATTTTGGC
GACCGATGGATCCGCGGCTTCCAGTCGGGTGGGAAACTTATTGCTCGAGTATCCATCAAAACCCATGAAGGGGCC
AAGAAGGCTGAAGTCGAGGCACACGCCAAGGCATCGTTGGCGTTTTGGGGAATCTCCGGGGACTTCAGCGCGACA
GTTAAAAACAGCATGAAAAGGTTAGACCAACACGCCGGTGTCCATATATCGATACACTACCAAGGAGTTTTGGGC
AGAGAGATGTTGAAGTCGGCGCCTGAGAACATTGCGGTGGGTTCTGCCGAGGGATCGTTTGGACAGGCCAAATTA
TGGGCAGACCGGTTCATCGAGAGAGCCTGCGACCACGACTATCCCTATGCGGCCCTCCTTGACTCATACAAAACT
CTCGAAAACTTCCCAGCAAATCAAGAAGTTGTGGACTATAGGGCTGCAAAAAGTGAGGCTAAATTTCTTTTGCAG
GATCTGGTCAAGCTTTCGGAAATGACAACATTGCTTCGGACCTACGATCTGAGCGACGCCGTGAAATATGAGATC
GACCGCGCCGAAGCACACCTTATTGAAGCTTCTCGGACCTGGGTTGAGAATACCGCCATCGATCCAAGTCGTGCT
GAAGAATCGAGAGAGATCCTTCGCGCGTCGTTCAACACCACATTCTATGCCCCGTACAGAAAATACTTAGAGAAG
AGAGTTGCACTCTACGAACGCCCAAACTTCGAAGGGAAGTCCATTGCTGTCACCACGCCTACTGGGAAATGCGTC
GACGTGCCGATGAGTTTCAATGATGTCGCTGCTTCATTTCGGTTGGAGATGACCGCTGCTTGCCGGTTTCACACC
GACTTCGGATGCCGAGGCTCTTTCTTTCTTGCCTGGGAAGACGAAGACAATCTTCCATCCGATCGCCCCGAATTT
AGCGACGCCATTAGCTCTCTTTCCTGCTCGCCCTCTCAGGCTCGAGAACAAAATGAGAGGTGTGGTCCAGACGGC
GGACACCATGTTTGTGCGCAGGGGCTGTGCTGCTCGAAACATGGCTACTGCGGGTTGACTGATGCTCATTGCGTG
AGTTGTCAAGAAGGCTTCGGCATCTGCTCATCTCAACCACAGTTTGACGACATTAGCCGTCACGTTCAATCTTGG
TGGGAGCGTGGAGAGCAAGAGACAGACCGCTCCGATCAGTGTAGGCAACAGTGTCATCAACCATCAACTTGGGGA
AAAGAACTGGAGCCATTCTGCAGACTTCGATGCGACGAGGAAGAAAAACTAACTCAAAAAGAGGGTTCAGCGATT
GAAGACCACATTCGACAGTGGGGGACACGGGGAGCGCAACAATTCGACATTTGCAGACAAGACTGTGATCGACTG
GCAGATAAAAACGGACGATGGCGAAGGACACGAGCACCTTTTTGCAGACAACAATGTGATAATGAACAAAAGGAC
CAAGAAAGCAAAGCAATTGACCGCCACATTGAATATTGGGCTGGACCTGGAGGGCAAGAATTTGGTAAGTGCCAG
AAAGACTGCAATCAGCTCGCTGGTCTGGCAGGAAAATGGCGAAACGAGCGAGTACCATATTGCATACACCGATGC
AGACTCGAATATTATAGGATGATACAGGATTTCGCGTTGCGGGGAGAGTTGGAATTCCACAAGGCAGATGATCGA
CTTGAGAGGCGCATTAGCATGATGAGACAATCCCTGGAGATTTCAAGACAGACGGCTGCTCGTGGACGATTGCCT
GAAATTAAACTGGGCCTGTTTAAGGATATCGAAGAATTTGATCGATTCTTCGACGATTTTTTTCGAGAAATTCGA
CAAGAAGCTCAAGCAATTGACGAGTTTATCAAAAGTTGGCCTGGATCTGAAAAGCAACAATTCGACGAGTGCAGG
CAAGGCTGTGATCGACTGGCAGGTCAAACAGGACGATGGCGGAAAAAACGAGTACCATTTTGCCAACGACGATGC
CATCACGAAGAGGCTAAAGCTGGTGGCGGGCACATTGTTATGTTAAATACCGGCCCGAACGATTACATGTATCAT
CTGGAGCTACACATTGGCCTTTTGCAAGACCGTTATCAGCATAAAGTCGTCGTGGAAACCAGCCTCTTTAACGTA
ACACACAAATTTTTGGCGGAGACTCATGGGTTCCACGGCTATGCTGGCAAGTTCTCGCAGGATATTATTGCGTAC
ATCGCCGAGCTTGATGACGTCGCGTTCGTTGAAGAGGATACGATTATGTCTATTCCCCCGCCTATCGTCGAATCG
GAGTCGGAACCTGCAGTGGAAGAGGCAGTAGATGAGACGAACGGACTAGAAAGAAGGCAGGGGACCCGTGTCCTG
CCGTTGACGTTTGCGACACAGGACCACGCGCCTTGGAACCTTTACGCCATCTCTCAAAGACACCCGCCGCCAAAG
TTAAAGCCGAATTGTTTCTTTAAGTACTATCACAATTCACTCGCTGGCGAGAATACCTACGCATATGTCATCGAC
ACGGGTGTTCTATACACGCATCAACAATTTGAGGGTCGCGCCGAACACGGCTGCACTGTCAAATACGGCGTCCAA
GGCTGCAGCACAAGTCCGAGCGATGCTACCGATACCCTTGGTCACGGAACCCACGTTGCTGGAATCATTGCCTCG
AAGACTTATGGCGTAGCCAAGAAGGCCAAGGTGATCTCTGTCAAGGTTTTTGACGAGAACGGAAACAGCCCCAAA
TCCGCTACAATAGATGCATTCGCTTGGGCCGTTCATGATATCCGTGTCAAGGGTCGTCGCGACAAGGCTGTTATT
AACATCTCAGCTGGTGGTGGACAGTCGGATATCCAGAATGCTGCCATCAACAGTGCTTTTGAGGCGCTAGGTATT
ATAACTGTCGTCTCCGCCGGGAACGATGGCAGGCCTGCTTCCGAGAAGTCACCTGCTTCCGCAGATAAAGCTATA
ACGGTTGGAAGCATGAGAAGAGACTGGAGTGTGGATCCTGATTCTAACTTTGGCCCTGAGGTCGATATTCTGGCC
CCAGGACAAGCTATCGTCTCACTTTCGAATCGACACGATGGTGCTTTTACAACTAGGTTTGGCACAGTAGCTATG
TCTGGCAGCTCCATGGCTACACCTCATGTTGCCGGCCTGGCTTTGTACGCCATGTCCGTTTACGGCATCAAGGCA
GATGGTATCAAACAATTCCTTATTGATACCGCCACAAAGAGCAAAATTACTGGTCATCTTCAGGGCACAGAGAAC
CGACTTGCCAATAACAATAATGCGAAGCAGAATCTACATCATTCGGAAGACCCCTGTATCTAG
Transcript >Hirsu2|8659
ATGCCGCTTCGCGAAGATGGCGCATTAACACCTAGTGCAAATGTGGCCGACGAATATATGCCTTTTCTGTTTACG
CCACCTAGCGGAGATGCGACTGGCATAGACAAACTGTCATACTTTGCACCACCTGAGTCGAACACGGAGGTAAAA
TCAGTGCCTGACCGGGACGGCGCTGGAAAAGACGCGGCTATTCAGGTGGCTAGCCGTGATCAACCTGGCGCTGAC
TTGACTGCTCGATCGCTTGACCAAAGCAGATGCTCTTCCCTTAGTATCACGGCAGACTCCATACTCACGAAAGAT
TACCAGTCTTATTTGACGGCCCTTGACGTGAGTGCTTCCGCGACCGTATCTGGTTGGGGCCAGAGCGCATCTATA
TCAGGTCATTATCTGGACCAGGCAAGGCTGTCCGATAGCGACTTGACATACGTGGCCATAATCGAAATCCAGAGA
CAGCAAATTTCGAACGACGTATTCAAATTCAATGACGATCTCTATAACAGTTTAAGTTTCACCGAGAATTTTGGC
GACCGATGGATCCGCGGCTTCCAGTCGGGTGGGAAACTTATTGCTCGAGTATCCATCAAAACCCATGAAGGGGCC
AAGAAGGCTGAAGTCGAGGCACACGCCAAGGCATCGTTGGCGTTTTGGGGAATCTCCGGGGACTTCAGCGCGACA
GTTAAAAACAGCATGAAAAGGTTAGACCAACACGCCGGTGTCCATATATCGATACACTACCAAGGAGTTTTGGGC
AGAGAGATGTTGAAGTCGGCGCCTGAGAACATTGCGGTGGGTTCTGCCGAGGGATCGTTTGGACAGGCCAAATTA
TGGGCAGACCGGTTCATCGAGAGAGCCTGCGACCACGACTATCCCTATGCGGCCCTCCTTGACTCATACAAAACT
CTCGAAAACTTCCCAGCAAATCAAGAAGTTGTGGACTATAGGGCTGCAAAAAGTGAGGCTAAATTTCTTTTGCAG
GATCTGGTCAAGCTTTCGGAAATGACAACATTGCTTCGGACCTACGATCTGAGCGACGCCGTGAAATATGAGATC
GACCGCGCCGAAGCACACCTTATTGAAGCTTCTCGGACCTGGGTTGAGAATACCGCCATCGATCCAAGTCGTGCT
GAAGAATCGAGAGAGATCCTTCGCGCGTCGTTCAACACCACATTCTATGCCCCGTACAGAAAATACTTAGAGAAG
AGAGTTGCACTCTACGAACGCCCAAACTTCGAAGGGAAGTCCATTGCTGTCACCACGCCTACTGGGAAATGCGTC
GACGTGCCGATGAGTTTCAATGATGTCGCTGCTTCATTTCGGTTGGAGATGACCGCTGCTTGCCGGTTTCACACC
GACTTCGGATGCCGAGGCTCTTTCTTTCTTGCCTGGGAAGACGAAGACAATCTTCCATCCGATCGCCCCGAATTT
AGCGACGCCATTAGCTCTCTTTCCTGCTCGCCCTCTCAGGCTCGAGAACAAAATGAGAGGTGTGGTCCAGACGGC
GGACACCATGTTTGTGCGCAGGGGCTGTGCTGCTCGAAACATGGCTACTGCGGGTTGACTGATGCTCATTGCGTG
AGTTGTCAAGAAGGCTTCGGCATCTGCTCATCTCAACCACAGTTTGACGACATTAGCCGTCACGTTCAATCTTGG
TGGGAGCGTGGAGAGCAAGAGACAGACCGCTCCGATCAGTGTAGGCAACAGTGTCATCAACCATCAACTTGGGGA
AAAGAACTGGAGCCATTCTGCAGACTTCGATGCGACGAGGAAGAAAAACTAACTCAAAAAGAGGGTTCAGCGATT
GAAGACCACATTCGACAGTGGGGGACACGGGGAGCGCAACAATTCGACATTTGCAGACAAGACTGTGATCGACTG
GCAGATAAAAACGGACGATGGCGAAGGACACGAGCACCTTTTTGCAGACAACAATGTGATAATGAACAAAAGGAC
CAAGAAAGCAAAGCAATTGACCGCCACATTGAATATTGGGCTGGACCTGGAGGGCAAGAATTTGGTAAGTGCCAG
AAAGACTGCAATCAGCTCGCTGGTCTGGCAGGAAAATGGCGAAACGAGCGAGTACCATATTGCATACACCGATGC
AGACTCGAATATTATAGGATGATACAGGATTTCGCGTTGCGGGGAGAGTTGGAATTCCACAAGGCAGATGATCGA
CTTGAGAGGCGCATTAGCATGATGAGACAATCCCTGGAGATTTCAAGACAGACGGCTGCTCGTGGACGATTGCCT
GAAATTAAACTGGGCCTGTTTAAGGATATCGAAGAATTTGATCGATTCTTCGACGATTTTTTTCGAGAAATTCGA
CAAGAAGCTCAAGCAATTGACGAGTTTATCAAAAGTTGGCCTGGATCTGAAAAGCAACAATTCGACGAGTGCAGG
CAAGGCTGTGATCGACTGGCAGGTCAAACAGGACGATGGCGGAAAAAACGAGTACCATTTTGCCAACGACGATGC
CATCACGAAGAGGCTAAAGCTGGTGGCGGGCACATTGTTATGTTAAATACCGGCCCGAACGATTACATGTATCAT
CTGGAGCTACACATTGGCCTTTTGCAAGACCGTTATCAGCATAAAGTCGTCGTGGAAACCAGCCTCTTTAACGTA
ACACACAAATTTTTGGCGGAGACTCATGGGTTCCACGGCTATGCTGGCAAGTTCTCGCAGGATATTATTGCGTAC
ATCGCCGAGCTTGATGACGTCGCGTTCGTTGAAGAGGATACGATTATGTCTATTCCCCCGCCTATCGTCGAATCG
GAGTCGGAACCTGCAGTGGAAGAGGCAGTAGATGAGACGAACGGACTAGAAAGAAGGCAGGGGACCCGTGTCCTG
CCGTTGACGTTTGCGACACAGGACCACGCGCCTTGGAACCTTTACGCCATCTCTCAAAGACACCCGCCGCCAAAG
TTAAAGCCGAATTGTTTCTTTAAGTACTATCACAATTCACTCGCTGGCGAGAATACCTACGCATATGTCATCGAC
ACGGGTGTTCTATACACGCATCAACAATTTGAGGGTCGCGCCGAACACGGCTGCACTGTCAAATACGGCGTCCAA
GGCTGCAGCACAAGTCCGAGCGATGCTACCGATACCCTTGGTCACGGAACCCACGTTGCTGGAATCATTGCCTCG
AAGACTTATGGCGTAGCCAAGAAGGCCAAGGTGATCTCTGTCAAGGTTTTTGACGAGAACGGAAACAGCCCCAAA
TCCGCTACAATAGATGCATTCGCTTGGGCCGTTCATGATATCCGTGTCAAGGGTCGTCGCGACAAGGCTGTTATT
AACATCTCAGCTGGTGGTGGACAGTCGGATATCCAGAATGCTGCCATCAACAGTGCTTTTGAGGCGCTAGGTATT
ATAACTGTCGTCTCCGCCGGGAACGATGGCAGGCCTGCTTCCGAGAAGTCACCTGCTTCCGCAGATAAAGCTATA
ACGGTTGGAAGCATGAGAAGAGACTGGAGTGTGGATCCTGATTCTAACTTTGGCCCTGAGGTCGATATTCTGGCC
CCAGGACAAGCTATCGTCTCACTTTCGAATCGACACGATGGTGCTTTTACAACTAGGTTTGGCACAGTAGCTATG
TCTGGCAGCTCCATGGCTACACCTCATGTTGCCGGCCTGGCTTTGTACGCCATGTCCGTTTACGGCATCAAGGCA
GATGGTATCAAACAATTCCTTATTGATACCGCCACAAAGAGCAAAATTACTGGTCATCTTCAGGGCACAGAGAAC
CGACTTGCCAATAACAATAATGCGAAGCAGAATCTACATCATTCGGAAGACCCCTGTATCTAG
Gene >Hirsu2|8659
ATGCCGCTTCGCGAAGATGGCGCATTAACACCTAGTGCAAATGTGGCCGACGAATATATGCCTTTTCTGTTTACG
CCACCTAGCGGAGATGCGACTGGCATAGACAAACTGTCATACTTTGCACCACCTGAGTCGAACACGGAGGTAAAA
TCAGTGCCTGACCGGGACGGCGCTGGAAAAGACGCGGCTATTCAGGTGGCTAGCCGTGATCAACCTGGCGCTGAC
TTGACTGCTCGATCGCTTGACCAAAGCAGATGCTCTTCCCTTAGTATCACGGCAGACTCCATACTCACGAAAGAT
TACCAGTCTTATTTGACGGCCCTTGACGTGAGTGCTTCCGCGACCGTATCTGGTTGGGGCCAGAGCGCATCTATA
TCAGGTCATTATCTGGACCAGGCAAGGCTGTCCGATAGCGACTTGACATACGTGGCCATAATCGAAATCCAGAGA
CAGCAAATTTCGAACGACGTATTCAAATTCAATGACGATCTCTATAACAGTTTAAGTTTCACCGAGAATTTTGGC
GACCGATGGATCCGCGGCTTCCAGTCGGGTGGGAAACTTATTGCTCGAGTATCCATCAAAACCCATGAAGGGGCC
AAGAAGGCTGAAGTCGAGGCACACGCCAAGGCATCGTTGGCGTTTTGGGGAATCTCCGGGGACTTCAGCGCGACA
GTTAAAAACAGCATGAAAAGGTTAGACCAACACGCCGGTGTCCATATATCGATACACTACCAAGGAGTTTTGGGC
AGAGAGATGTTGAAGTCGGCGCCTGAGAACATTGCGGTGGGTTCTGCCGAGGGATCGTTTGGACAGGCCAAATTA
TGGGCAGACCGGTTCATCGAGAGAGCCTGCGACCACGACTATCCCTATGCGGCCCTCCTTGACTCATACAAAACT
CTCGAAAACTTCCCAGCAAATCAAGAAGTTGTGGACTATAGGGCTGCAAAAAGTGAGGCTAAATTTCTTTTGCAG
GATCTGGTCAAGCTTTCGGAAATGACAACATTGCTTCGGACCTACGATCTGAGCGACGCCGTGAAATATGAGATC
GACCGCGCCGAAGCACACCTTATTGAAGCTTCTCGGACCTGGGTTGAGAATACCGCCATCGATCCAAGTCGTGCT
GAAGAATCGAGAGAGATCCTTCGCGCGTCGTTCAACACCACATTCTATGCCCCGTACAGAAAATACTTAGAGAAG
AGAGTTGCACTCTACGAACGCCCAAACTTCGAAGGGAAGTCCATTGCTGTCACCACGCCTACTGGGAAATGCGTC
GACGTGCCGATGAGTTTCAATGATGTCGCTGCTTCATTTCGGTTGGAGATGACCGCTGCTTGCCGGTTTCACACC
GACTTCGGATGCCGAGGCTCTTTCTTTCTTGCCTGGGAAGACGAAGACAATCTTCCATCCGATCGCCCCGAATTT
AGCGACGCCATTAGCTCTCTTTCCTGCTCGCCCTCTCAGGCTCGAGAACAAAATGAGAGGTGTGGTCCAGACGGC
GGACACCATGTTTGTGCGCAGGGGCTGTGCTGCTCGAAACATGGCTACTGCGGGTTGACTGATGCTCATTGCGTG
AGTTGTCAAGAAGGCTTCGGCATCTGCTCATCTCAACCACAGTTTGACGACATTAGCCGTCACGTTCAATCTTGG
TGGGAGCGTGGAGAGCAAGAGACAGACCGCTCCGATCAGTGTAGGCAACAGTGTCATCAACCATCAACTTGGGGA
AAAGAACTGGAGCCATTCTGCAGACTTCGATGCGACGAGGAAGAAAAACTAACTCAAAAAGAGGGTTCAGCGATT
GAAGACCACATTCGACAGTGGGGGACACGGGGAGCGCAACAATTCGACATTTGCAGACAAGACTGTGATCGACTG
GCAGATAAAAACGGACGATGGCGAAGGACACGAGCACCTTTTTGCAGACAACAATGTGATAATGAACAAAAGGAC
CAAGAAAGCAAAGCAATTGACCGCCACATTGAATATTGGGCTGGACCTGGAGGGCAAGAATTTGGTAAGTGCCAG
AAAGACTGCAATCAGCTCGCTGGTCTGGCAGGAAAATGGCGAAACGAGCGAGTACCATATTGCATACACCGATGC
AGACTCGAATATTATAGGATGATACAGGATTTCGCGTTGCGGGGAGAGTTGGAATTCCACAAGGCAGATGATCGA
CTTGAGAGGCGCATTAGCATGATGAGACAATCCCTGGAGATTTCAAGACAGACGGCTGCTCGTGGACGATTGCCT
GAAATTAAACTGGGCCTGTTTAAGGATATCGAAGAATTTGATCGATTCTTCGACGATTTTTTTCGAGAAATTCGA
CAAGAAGCTCAAGCAATTGACGAGTTTATCAAAAGTTGGCCTGGATCTGAAAAGCAACAATTCGACGAGTGCAGG
CAAGGCTGTGATCGACTGGCAGGTCAAACAGGACGATGGCGGAAAAAACGAGTACCATTTTGCCAACGACGATGC
CATCACGAAGAGGCTAAAGCTGGTGGCGGGCACATTGTTATGTTAAATACCGGCCCGAACGATTACATGTATCAT
CTGGAGCTACACATTGGCCTTTTGCAAGACCGTTATCAGCATAAAGTCGTCGTGGAAACCAGCCTCTTTAACGTA
ACACACAAATTTTTGGCGGAGACTCATGGGTTCCACGGCTATGCTGGCAAGTTCTCGCAGGATATTATTGCGTAC
ATCGCCGAGCTTGATGACGTCGCGTTCGTTGAAGAGGATACGATTATGTCTATTCCCCCGCCTATCGTCGAATCG
GAGTCGGAACCTGCAGTGGAAGAGGCAGTAGATGAGACGAACGGACTAGAAAGAAGGCAGGGGACCCGTGTCCTG
CCGTTGACGTTTGCGACACAGGACCACGCGCCTTGGAACCTTTACGCCATCTCTCAAAGACACCCGCCGCCAAAG
TTAAAGCCGAATTGTTTCTTTAAGTACTATCACAATTCACTCGCTGGCGAGAATACCTACGCATATGTCATCGAC
ACGGGTGTTCTATACACGCATCAACAATTTGAGGGTCGCGCCGAACACGGCTGCACTGTCAAATACGGCGTCCAA
GGCTGCAGCACAAGTCCGAGCGATGCTACCGATACCCTTGGTCACGGAACCCACGTTGCTGGAATCATTGCCTCG
AAGACTTATGGCGTAGCCAAGAAGGCCAAGGTGATCTCTGTCAAGGTTTTTGACGAGAACGGAAACAGCCCCAAA
TCCGCTACAATAGATGCATTCGCTTGGGCCGTTCATGATATCCGTGTCAAGGGTCGTCGCGACAAGGCTGTTATT
AACATCTCAGCTGGTGGTGGACAGTCGGATATCCAGAATGCTGCCATCAACAGTGCTTTTGAGGCGCTAGGTATT
ATAACTGTCGTCTCCGCCGGGAACGATGGCAGGCCTGCTTCCGAGAAGTCACCTGCTTCCGCAGATAAAGCTATA
ACGGTTGGAAGCATGAGAAGAGACTGGAGTGTGGATCCTGATTCTAACTTTGGCCCTGAGGTCGATATTCTGGCC
CCAGGACAAGCTATCGTCTCACTTTCGAATCGACACGATGGTGCTTTTACAACTAGGTTTGGCACAGTAGCTATG
TCTGGCAGCTCCATGGCTACACCTCATGTTGCCGGCCTGGCTTTGTACGCCATGTCCGTTTACGGCATCAAGGCA
GATGGTATCAAACAATTCCTTATTGATACCGCCACAAAGAGCAAAATTACTGGTCATCTTCAGGGCACAGAGAAC
CGACTTGCCAATAACAATAATGCGAAGCAGAATCTACATCATTCGGAAGACCCCTGTATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail