Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8656
Gene name
LocationContig_58:1497..3234
Strand+
Gene length (bp)1737
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 8.4E-22 76 451
PF00067 p450 Cytochrome P450 7.8E-11 487 568

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 350 553 2.0E-12
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 344 572 3.0E-12
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 344 572 3.0E-12
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 246 558 3.0E-12
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 329 558 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 350 553 2.0E-12
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 344 572 3.0E-12
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 344 572 3.0E-12
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 246 558 3.0E-12
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 329 558 3.0E-12
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 217 546 5.0E-12
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 307 547 7.0E-12
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 335 548 1.0E-11
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 296 550 2.0E-11
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 236 547 3.0E-11
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 280 551 3.0E-11
sp|Q9SLP1|C78A9_ARATH Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 335 551 4.0E-11
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 335 548 4.0E-11
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 344 560 4.0E-11
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 315 572 6.0E-11
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 280 551 6.0E-11
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 282 548 7.0E-11
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 296 550 8.0E-11
sp|Q1ZXL7|C5083_DICDI Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 319 548 9.0E-11
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 348 549 9.0E-11
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 302 552 1.0E-10
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 292 551 1.0E-10
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 145 550 1.0E-10
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 333 558 1.0E-10
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 259 576 1.0E-10
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 207 550 2.0E-10
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 301 547 2.0E-10
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 316 551 2.0E-10
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 316 551 2.0E-10
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 255 548 3.0E-10
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 266 550 3.0E-10
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 335 548 3.0E-10
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 335 550 4.0E-10
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 258 551 5.0E-10
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 283 548 6.0E-10
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 283 548 6.0E-10
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 292 548 7.0E-10
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 307 546 8.0E-10
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 339 550 1.0E-09
sp|Q92116|CP1A1_STECH Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 296 548 1.0E-09
sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 344 551 1.0E-09
sp|Q1ZXH9|CP51_DICDI Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 246 573 1.0E-09
sp|Q8K0C4|CP51A_MOUSE Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 275 575 1.0E-09
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 315 547 1.0E-09
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 280 578 1.0E-09
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 351 551 2.0E-09
sp|Q2XNC9|CP2D6_PANPA Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 289 551 2.0E-09
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 348 551 2.0E-09
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 289 547 2.0E-09
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 307 551 2.0E-09
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 335 550 2.0E-09
sp|Q2XNC8|CP2D6_PANTR Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 289 551 2.0E-09
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 314 546 3.0E-09
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 292 551 3.0E-09
sp|Q64654|CP51A_RAT Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 275 575 4.0E-09
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 296 550 4.0E-09
sp|O81971|C71D9_SOYBN Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1 267 552 5.0E-09
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 257 551 5.0E-09
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 334 552 5.0E-09
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 301 549 5.0E-09
sp|P9WPP9|CP51_MYCTU Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 348 550 6.0E-09
sp|P9WPP8|CP51_MYCTO Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 348 550 6.0E-09
sp|P0A513|CP51_MYCBO Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 348 550 6.0E-09
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 344 569 6.0E-09
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 335 548 7.0E-09
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 267 549 8.0E-09
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 350 554 8.0E-09
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 335 548 8.0E-09
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 296 548 8.0E-09
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 300 550 9.0E-09
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 299 551 9.0E-09
sp|Q9V559|CP4P3_DROME Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 333 547 9.0E-09
sp|Q42797|TCMO_SOYBN Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 282 548 9.0E-09
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 282 546 9.0E-09
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 335 548 9.0E-09
sp|Q16850|CP51A_HUMAN Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 275 575 9.0E-09
sp|Q4R8S6|CP51A_MACFA Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 275 575 9.0E-09
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 270 551 1.0E-08
sp|P48522|TCMO_CATRO Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 305 547 1.0E-08
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 340 551 1.0E-08
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 348 547 1.0E-08
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 292 550 1.0E-08
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 314 548 1.0E-08
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 334 552 1.0E-08
sp|Q5RE72|CP51A_PONAB Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 275 575 2.0E-08
sp|Q96423|TCMO_GLYEC Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 242 548 2.0E-08
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 296 548 2.0E-08
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 340 551 2.0E-08
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 337 547 2.0E-08
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 335 550 2.0E-08
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 339 551 2.0E-08
sp|O46420|CP51A_PIG Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 275 575 3.0E-08
sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 290 551 3.0E-08
sp|P37115|TCMO_VIGRR Trans-cinnamate 4-monooxygenase OS=Vigna radiata var. radiata GN=CYP73A2 PE=1 SV=1 312 548 3.0E-08
sp|Q9SRQ1|C89A9_ARATH Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1 315 549 3.0E-08
sp|Q7XHW5|C14B1_ORYSJ Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2 298 577 3.0E-08
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 188 549 3.0E-08
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 299 551 3.0E-08
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 250 567 3.0E-08
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 336 558 3.0E-08
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 335 548 3.0E-08
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 278 547 4.0E-08
sp|Q04468|TCMO_HELTU Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 83 548 4.0E-08
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 348 547 4.0E-08
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 344 550 4.0E-08
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 348 550 4.0E-08
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 289 551 4.0E-08
sp|H2DH19|C7D31_PANGI Cytochrome P450 CYP71D312 OS=Panax ginseng PE=2 SV=1 249 551 5.0E-08
sp|Q29488|CP2DH_MACFA Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 290 551 5.0E-08
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 303 547 6.0E-08
sp|Q7Z1V1|CP51_TRYCC Sterol 14-alpha demethylase OS=Trypanosoma cruzi (strain CL Brener) GN=CYP51 PE=1 SV=1 281 578 6.0E-08
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 333 551 6.0E-08
sp|Q9V4T3|C4AD1_DROME Probable cytochrome P450 4ad1 OS=Drosophila melanogaster GN=Cyp4ad1 PE=2 SV=1 334 547 6.0E-08
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 335 553 6.0E-08
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 314 546 6.0E-08
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 299 551 7.0E-08
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 275 551 7.0E-08
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 348 550 8.0E-08
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 337 546 8.0E-08
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 348 552 9.0E-08
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 348 552 9.0E-08
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 333 551 1.0E-07
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 314 546 1.0E-07
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 266 552 1.0E-07
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 337 547 1.0E-07
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 314 546 1.0E-07
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 335 560 1.0E-07
sp|Q9W683|CP1A1_LIZSA Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 335 573 1.0E-07
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 335 548 1.0E-07
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 335 552 1.0E-07
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 184 578 1.0E-07
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 348 550 1.0E-07
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 314 546 1.0E-07
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 348 550 1.0E-07
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 308 550 1.0E-07
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 95 550 2.0E-07
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 339 558 2.0E-07
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 335 550 2.0E-07
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 344 569 2.0E-07
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 258 551 2.0E-07
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 302 549 2.0E-07
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 335 551 2.0E-07
sp|Q6WNQ9|C81E9_MEDTR Isoflavone 3'-hydroxylase (Fragment) OS=Medicago truncatula GN=CYP81E9 PE=1 SV=1 344 549 2.0E-07
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 348 551 2.0E-07
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 348 547 2.0E-07
sp|Q4PJW3|CP51A_BOVIN Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 275 575 3.0E-07
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 314 546 3.0E-07
sp|Q29473|CP2DF_CANLF Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 290 551 3.0E-07
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 335 548 3.0E-07
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 335 551 3.0E-07
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 337 547 3.0E-07
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 331 550 3.0E-07
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 348 547 3.0E-07
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 297 553 4.0E-07
sp|Q9LNJ4|C70A2_ARATH Cytochrome P450 703A2 OS=Arabidopsis thaliana GN=CYP703A2 PE=2 SV=1 329 569 4.0E-07
sp|O46658|CP2DP_PIG Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 299 551 4.0E-07
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 314 546 4.0E-07
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 350 552 4.0E-07
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 299 551 4.0E-07
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 314 546 4.0E-07
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 335 550 4.0E-07
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 314 546 4.0E-07
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 347 555 5.0E-07
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 251 566 5.0E-07
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 350 563 5.0E-07
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 281 551 5.0E-07
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 314 546 5.0E-07
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 348 551 5.0E-07
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 335 550 6.0E-07
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 250 552 7.0E-07
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 266 550 7.0E-07
sp|Q64403|CP2DG_CAVPO Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 350 552 8.0E-07
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 346 543 8.0E-07
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 299 551 8.0E-07
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 349 574 8.0E-07
sp|P92994|TCMO_ARATH Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 312 548 1.0E-06
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 350 551 1.0E-06
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 339 552 1.0E-06
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 258 551 1.0E-06
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 270 552 1.0E-06
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 340 555 1.0E-06
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 339 572 2.0E-06
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 350 531 2.0E-06
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 335 550 2.0E-06
sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 339 577 2.0E-06
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 297 553 2.0E-06
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 297 553 2.0E-06
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 350 550 3.0E-06
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 350 550 3.0E-06
sp|P12938|CP2D3_RAT Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 350 551 3.0E-06
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 294 552 4.0E-06
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 348 551 4.0E-06
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 348 549 4.0E-06
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 348 550 4.0E-06
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 350 550 5.0E-06
sp|Q64562|CP21A_RAT Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 292 551 6.0E-06
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 305 555 7.0E-06
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 348 553 8.0E-06
sp|O64899|C80B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 335 578 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8656
MDRHTSAVWAVAAGLLLVLALVVVQRAYPRPLPGIPYNRAATRRLWGDLPEIAEAGSNGGSFRTWFLTQAIKHNS
AITQVFLGPLVKPSVIVSDYREVSDILKHRDAVDFKRGLKVQAFRGLLPHAFPAMETFDAGFKRSRDLARDLMAP
SVLHAMNAPRVHEVASDLVQLWRLKCRLAEDHPFDLTRDLCEFSFDAILSAAMGLDAEGGDVKRQLERMRSCAGD
DVRGRLSPDTDDPVVFESGPKSAKLAALQEQVDSLWKAFAIPWPRLYHSLNNLRPRVRAARATLQKHIVSQAALA
RERLTRDGQEPRCALDFVIQREMRAAARERRVAVLDDPHILQPIHGYLIAGHDTSAGSLSWLMRRLVLHPEQQAL
VRDDLRRTYAEARAARRPPTAAELVGGRRCARLEAFVQETLRLDTPVLNIMVMTRTEAVVLGHRLPADTRVFVNL
TGPSINMPSLAVDEERRSPTSRAHKSSGAARDNWDDADPAAFRPERWLRPDADGKPVYDAGLGPELAFSAGNRGC
WGKRLGNLELRIVLALLIWSFEFELPRKFVSWDTYDSLVTAPKACLVRIKELP*
Coding >Hirsu2|8656
ATGGACCGACATACATCTGCCGTCTGGGCCGTGGCCGCAGGCCTGCTTCTCGTGCTGGCCCTCGTCGTGGTGCAG
CGAGCATATCCTCGCCCGCTCCCCGGCATCCCCTACAACCGCGCCGCCACGAGGCGGCTCTGGGGCGACCTCCCC
GAGATCGCAGAGGCGGGCAGCAACGGCGGCAGCTTCAGGACCTGGTTCCTGACGCAGGCGATCAAGCACAACTCG
GCCATCACCCAGGTCTTCCTGGGCCCGCTGGTCAAGCCGTCCGTGATCGTGTCCGACTACCGCGAGGTCAGCGAC
ATCCTCAAGCATCGCGATGCCGTCGACTTCAAGCGCGGCCTCAAGGTGCAGGCCTTCCGCGGCCTCCTCCCCCAC
GCGTTCCCGGCCATGGAGACCTTCGATGCCGGCTTCAAGCGGTCGCGAGACCTGGCCAGGGATCTCATGGCGCCG
TCTGTCCTGCACGCCATGAACGCGCCTCGCGTCCACGAAGTCGCCTCCGACCTCGTGCAGCTGTGGCGCCTGAAG
TGCCGCCTGGCCGAGGACCATCCGTTCGACCTGACCAGGGACCTGTGCGAGTTCTCCTTCGACGCCATCCTGAGC
GCCGCCATGGGCTTGGACGCCGAGGGGGGCGACGTCAAGCGCCAGCTGGAGCGCATGCGTTCGTGCGCCGGCGAC
GACGTCAGGGGCCGCCTCTCCCCGGACACGGACGATCCCGTCGTCTTCGAGTCGGGCCCCAAGTCGGCCAAGCTT
GCCGCGCTCCAGGAACAGGTGGACTCGCTCTGGAAGGCCTTCGCCATACCCTGGCCGCGGCTGTATCACAGCCTC
AACAACCTGAGGCCGCGGGTGCGCGCCGCCCGCGCGACGCTGCAGAAGCACATCGTGTCGCAGGCGGCGCTGGCG
AGGGAGCGGCTGACGAGAGACGGCCAGGAGCCGCGCTGCGCCCTCGACTTCGTCATCCAGCGCGAGATGCGCGCG
GCGGCCCGGGAGAGGCGCGTCGCCGTGCTCGACGACCCGCACATCCTGCAGCCCATCCACGGCTACCTGATCGCC
GGCCACGACACGTCCGCCGGCTCGCTGTCGTGGCTGATGCGCCGGCTCGTGCTGCACCCGGAGCAGCAGGCCCTG
GTCCGCGACGACCTCCGCCGCACGTACGCCGAGGCCCGGGCCGCCCGGAGGCCGCCCACGGCCGCCGAGCTGGTC
GGCGGCCGGCGCTGCGCCCGGCTGGAGGCCTTCGTGCAGGAGACGCTGCGGCTCGACACGCCCGTGCTCAACATC
ATGGTCATGACCCGGACCGAGGCCGTCGTGCTCGGCCACCGCCTGCCGGCCGACACACGCGTCTTCGTCAACCTG
ACGGGGCCGAGCATCAACATGCCGTCGCTGGCCGTCGACGAGGAGCGCCGCAGCCCGACGTCGCGCGCGCACAAG
TCGTCGGGCGCCGCCCGCGACAACTGGGACGACGCCGACCCGGCCGCCTTCCGCCCGGAGCGCTGGCTGCGCCCC
GACGCCGACGGGAAGCCCGTCTACGATGCCGGCCTCGGCCCGGAGCTGGCCTTCAGCGCGGGCAACAGGGGCTGC
TGGGGCAAGAGGCTGGGCAACCTGGAGTTGAGGATCGTCTTGGCGCTGCTGATCTGGTCCTTTGAGTTTGAGCTT
CCGCGCAAGTTTGTGAGCTGGGACACGTACGACTCGCTCGTTACGGCCCCCAAGGCGTGCCTTGTCCGTATCAAG
GAGCTTCCCTAA
Transcript >Hirsu2|8656
ATGGACCGACATACATCTGCCGTCTGGGCCGTGGCCGCAGGCCTGCTTCTCGTGCTGGCCCTCGTCGTGGTGCAG
CGAGCATATCCTCGCCCGCTCCCCGGCATCCCCTACAACCGCGCCGCCACGAGGCGGCTCTGGGGCGACCTCCCC
GAGATCGCAGAGGCGGGCAGCAACGGCGGCAGCTTCAGGACCTGGTTCCTGACGCAGGCGATCAAGCACAACTCG
GCCATCACCCAGGTCTTCCTGGGCCCGCTGGTCAAGCCGTCCGTGATCGTGTCCGACTACCGCGAGGTCAGCGAC
ATCCTCAAGCATCGCGATGCCGTCGACTTCAAGCGCGGCCTCAAGGTGCAGGCCTTCCGCGGCCTCCTCCCCCAC
GCGTTCCCGGCCATGGAGACCTTCGATGCCGGCTTCAAGCGGTCGCGAGACCTGGCCAGGGATCTCATGGCGCCG
TCTGTCCTGCACGCCATGAACGCGCCTCGCGTCCACGAAGTCGCCTCCGACCTCGTGCAGCTGTGGCGCCTGAAG
TGCCGCCTGGCCGAGGACCATCCGTTCGACCTGACCAGGGACCTGTGCGAGTTCTCCTTCGACGCCATCCTGAGC
GCCGCCATGGGCTTGGACGCCGAGGGGGGCGACGTCAAGCGCCAGCTGGAGCGCATGCGTTCGTGCGCCGGCGAC
GACGTCAGGGGCCGCCTCTCCCCGGACACGGACGATCCCGTCGTCTTCGAGTCGGGCCCCAAGTCGGCCAAGCTT
GCCGCGCTCCAGGAACAGGTGGACTCGCTCTGGAAGGCCTTCGCCATACCCTGGCCGCGGCTGTATCACAGCCTC
AACAACCTGAGGCCGCGGGTGCGCGCCGCCCGCGCGACGCTGCAGAAGCACATCGTGTCGCAGGCGGCGCTGGCG
AGGGAGCGGCTGACGAGAGACGGCCAGGAGCCGCGCTGCGCCCTCGACTTCGTCATCCAGCGCGAGATGCGCGCG
GCGGCCCGGGAGAGGCGCGTCGCCGTGCTCGACGACCCGCACATCCTGCAGCCCATCCACGGCTACCTGATCGCC
GGCCACGACACGTCCGCCGGCTCGCTGTCGTGGCTGATGCGCCGGCTCGTGCTGCACCCGGAGCAGCAGGCCCTG
GTCCGCGACGACCTCCGCCGCACGTACGCCGAGGCCCGGGCCGCCCGGAGGCCGCCCACGGCCGCCGAGCTGGTC
GGCGGCCGGCGCTGCGCCCGGCTGGAGGCCTTCGTGCAGGAGACGCTGCGGCTCGACACGCCCGTGCTCAACATC
ATGGTCATGACCCGGACCGAGGCCGTCGTGCTCGGCCACCGCCTGCCGGCCGACACACGCGTCTTCGTCAACCTG
ACGGGGCCGAGCATCAACATGCCGTCGCTGGCCGTCGACGAGGAGCGCCGCAGCCCGACGTCGCGCGCGCACAAG
TCGTCGGGCGCCGCCCGCGACAACTGGGACGACGCCGACCCGGCCGCCTTCCGCCCGGAGCGCTGGCTGCGCCCC
GACGCCGACGGGAAGCCCGTCTACGATGCCGGCCTCGGCCCGGAGCTGGCCTTCAGCGCGGGCAACAGGGGCTGC
TGGGGCAAGAGGCTGGGCAACCTGGAGTTGAGGATCGTCTTGGCGCTGCTGATCTGGTCCTTTGAGTTTGAGCTT
CCGCGCAAGTTTGTGAGCTGGGACACGTACGACTCGCTCGTTACGGCCCCCAAGGCGTGCCTTGTCCGTATCAAG
GAGCTTCCCTAA
Gene >Hirsu2|8656
ATGGACCGACATACATCTGCCGTCTGGGCCGTGGCCGCAGGCCTGCTTCTCGTGCTGGCCCTCGTCGTGGTGCAG
CGAGCATATCCTCGCCCGCTCCCCGGCATCCCCTACAACCGCGCCGCCACGAGGCGGCTCTGGGGCGACCTCCCC
GAGATCGCAGAGGCGGGCAGCAACGGCGGCAGCTTCAGGACCTGGTTCCTGACGCAGGCGATCAAGCACAACTCG
GCCATCACCCAGGTCTTCCTGGGCCCGCTGGTCAAGCCGTCCGTGATCGTGTCCGACTACCGCGAGGTCAGCGAC
ATCCTCAAGCATCGCGATGCCGTCGACTTCAAGCGCGGCCTCAAGGTGCAGGCCTTCCGCGGCCTCCTCCCCCAC
GCGTTCCCGGCCATGGAGACCTTCGATGCCGGCTTCAAGCGGTCGCGAGACCTGGCCAGGGATCTCATGGCGCCG
TCTGTCCTGCACGCCATGAACGCGCCTCGCGTCCACGAAGTCGCCTCCGACCTCGTGCAGCTGTGGCGCCTGAAG
TGCCGCCTGGCCGAGGACCATCCGTTCGACCTGACCAGGGACCTGTGCGAGTTCTCCTTCGACGCCATCCTGAGC
GCCGCCATGGGCTTGGACGCCGAGGGGGGCGACGTCAAGCGCCAGCTGGAGCGCATGCGTTCGTGCGCCGGCGAC
GACGTCAGGGGCCGCCTCTCCCCGGACACGGACGATCCCGTCGTCTTCGAGTCGGGCCCCAAGTCGGCCAAGCTT
GCCGCGCTCCAGGAACAGGTGGACTCGCTCTGGAAGGCCTTCGCCATACCCTGGCCGCGGCTGTATCACAGCCTC
AACAACCTGAGGCCGCGGGTGCGCGCCGCCCGCGCGACGCTGCAGAAGCACATCGTGTCGCAGGCGGCGCTGGCG
AGGGAGCGGCTGACGAGAGACGGCCAGGAGCCGCGCTGCGCCCTCGACTTCGTCATCCAGCGCGAGATGCGCGCG
GCGGCCCGGGAGAGGCGCGTCGCCGTGCTCGACGACCCGCACATCCTGCAGCCCATCCACGGCTACCTGATCGCC
GGCCACGACACGTCCGCCGGCTCGCTGTCGTGGCTGATGCGCCGGCTCGTGCTGCACCCGGAGCAGCAGGCCCTG
GTCCGCGACGACCTCCGCCGCACGTACGCCGAGGCCCGGGCCGCCCGGAGGCCGCCCACGGCCGCCGAGCTGGTC
GGCGGCCGGCGCTGCGCCCGGCTGGAGGCCTTCGTGCAGGAGACGCTGCGGCTCGACACGCCCGTGCTCAACATC
ATGGTCATGACCCGGACCGAGGCCGTCGTGCTCGGCCACCGCCTGCCGGCCGACACACGCGTCTTCGTCAACCTG
ACGGGGCCGAGCATCAACATGCCGTCGCTGGCCGTCGACGAGGAGCGCCGCAGCCCGACGTCGCGCGCGCACAAG
TCGTCGGGCGCCGCCCGCGACAACTGGGACGACGCCGACCCGGCCGCCTTCCGCCCGGAGCGCTGGCTGCGCCCC
GACGCCGACGGGAAGCCCGTCTACGATGCCGGCCTCGGCCCGGAGCTGGCCTTCAGCGCGGGCAACAGGGGCTGC
TGGGGCAAGAGGCTGGGCAACCTGGAGTTGAGGATCGTCTTGGCGCTGCTGATCTGGTCCTTTGAGTTTGAGCTT
CCGCGCAAGTTTGTGAGCTGGGACACGTACGACTCGCTCGTTACGGCCCCCAAGGCGTGCCTTGTCCGTATCAAG
GAGCTTCCCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail