Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8640
Gene name
LocationContig_577:15703..16120
Strand-
Gene length (bp)417
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03583 LIP Secretory lipase 4.8E-15 10 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AX63|LIPA_ARTBC Lipase A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00790 PE=3 SV=1 8 135 7.0E-32
sp|P9WK88|Y1592_MYCTO Probable inactive lipase MT1628 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1628 PE=3 SV=1 8 111 5.0E-12
sp|P9WK89|Y1592_MYCTU Probable inactive lipase Rv1592c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1592c PE=1 SV=1 8 111 7.0E-12
sp|Q9P8W0|LIP5_CANAL Lipase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP5 PE=3 SV=2 8 111 1.0E-09
sp|Q9P8W5|LIP2_CANAX Lipase 2 OS=Candida albicans GN=LIP2 PE=3 SV=1 28 137 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AX63|LIPA_ARTBC Lipase A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00790 PE=3 SV=1 8 135 7.0E-32
sp|P9WK88|Y1592_MYCTO Probable inactive lipase MT1628 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1628 PE=3 SV=1 8 111 5.0E-12
sp|P9WK89|Y1592_MYCTU Probable inactive lipase Rv1592c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1592c PE=1 SV=1 8 111 7.0E-12
sp|Q9P8W0|LIP5_CANAL Lipase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP5 PE=3 SV=2 8 111 1.0E-09
sp|Q9P8W5|LIP2_CANAX Lipase 2 OS=Candida albicans GN=LIP2 PE=3 SV=1 28 137 4.0E-08
sp|Q9P8W1|LIP4_CANAL Lipase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP4 PE=3 SV=1 8 94 3.0E-06
sp|Q9P4E8|LIP6_CANAL Lipase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIP6 PE=3 SV=1 28 133 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004806 triglyceride lipase activity Yes
GO:0016042 lipid catabolic process Yes
GO:1901575 organic substance catabolic process No
GO:0006629 lipid metabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0016298 lipase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0009056 catabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Peroxisomal targeting signal 0.2876 0.1028 0.8229 0.5155 0.45 0.4425 0.2286 0.2678 0.4439 0.6222

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup73
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1354
Ophiocordyceps australis 1348a (Ghana) OphauG2|7923
Ophiocordyceps australis map64 (Brazil) OphauB2|1074
Ophiocordyceps australis map64 (Brazil) OphauB2|4649
Ophiocordyceps australis map64 (Brazil) OphauB2|8009
Ophiocordyceps camponoti-floridani Ophcf2|02866
Ophiocordyceps camponoti-floridani Ophcf2|04877
Ophiocordyceps camponoti-floridani Ophcf2|05908
Ophiocordyceps camponoti-rufipedis Ophun1|2162
Ophiocordyceps camponoti-rufipedis Ophun1|3566
Ophiocordyceps camponoti-rufipedis Ophun1|5195
Ophiocordyceps kimflemingae Ophio5|4843
Ophiocordyceps kimflemingae Ophio5|6215
Ophiocordyceps subramaniannii Hirsu2|307
Ophiocordyceps subramaniannii Hirsu2|7669
Ophiocordyceps subramaniannii Hirsu2|8640 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8640
LLDDRRLLLTRPLAVRLVAENALGRAAPRVPVFVYKSTGDEISPVAETDGLVRRYWAAGAAVDYQRDAGSDHGSL
AVLAAPKALAWLRDALDGRLRPGCRTRTVLSSLLDPAAVEFLPQILIDALLGLLGSPVGPIIG*
Coding >Hirsu2|8640
CTGCTCGACGACCGGCGCCTGCTCCTCACCCGCCCGCTGGCGGTGCGGCTGGTGGCGGAGAACGCGCTGGGCCGC
GCCGCGCCCCGGGTCCCCGTCTTCGTCTACAAGTCGACCGGCGACGAGATCAGCCCGGTGGCCGAGACGGACGGC
CTCGTCCGCCGCTACTGGGCCGCCGGCGCCGCCGTCGACTACCAGCGCGACGCCGGCTCCGACCACGGCAGCCTC
GCCGTCCTGGCCGCGCCCAAGGCCCTGGCCTGGCTGCGCGACGCCCTCGACGGCCGCCTCCGCCCCGGCTGCCGC
ACCCGCACCGTGCTCTCCTCCCTGCTCGACCCGGCCGCCGTCGAGTTCCTGCCCCAGATCCTGATCGACGCGCTT
CTGGGCCTGCTGGGGAGCCCGGTCGGGCCCATCATCGGATGA
Transcript >Hirsu2|8640
CTGCTCGACGACCGGCGCCTGCTCCTCACCCGCCCGCTGGCGGTGCGGCTGGTGGCGGAGAACGCGCTGGGCCGC
GCCGCGCCCCGGGTCCCCGTCTTCGTCTACAAGTCGACCGGCGACGAGATCAGCCCGGTGGCCGAGACGGACGGC
CTCGTCCGCCGCTACTGGGCCGCCGGCGCCGCCGTCGACTACCAGCGCGACGCCGGCTCCGACCACGGCAGCCTC
GCCGTCCTGGCCGCGCCCAAGGCCCTGGCCTGGCTGCGCGACGCCCTCGACGGCCGCCTCCGCCCCGGCTGCCGC
ACCCGCACCGTGCTCTCCTCCCTGCTCGACCCGGCCGCCGTCGAGTTCCTGCCCCAGATCCTGATCGACGCGCTT
CTGGGCCTGCTGGGGAGCCCGGTCGGGCCCATCATCGGATGA
Gene >Hirsu2|8640
CTGCTCGACGACCGGCGCCTGCTCCTCACCCGCCCGCTGGCGGTGCGGCTGGTGGCGGAGAACGCGCTGGGCCGC
GCCGCGCCCCGGGTCCCCGTCTTCGTCTACAAGTCGACCGGCGACGAGATCAGCCCGGTGGCCGAGACGGACGGC
CTCGTCCGCCGCTACTGGGCCGCCGGCGCCGCCGTCGACTACCAGCGCGACGCCGGCTCCGACCACGGCAGCCTC
GCCGTCCTGGCCGCGCCCAAGGCCCTGGCCTGGCTGCGCGACGCCCTCGACGGCCGCCTCCGCCCCGGCTGCCGC
ACCCGCACCGTGCTCTCCTCCCTGCTCGACCCGGCCGCCGTCGAGTTCCTGCCCCAGATCCTGATCGACGCGCTT
CTGGGCCTGCTGGGGAGCCCGGTCGGGCCCATCATCGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail