Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8628
Gene name
LocationContig_576:5894..7545
Strand+
Gene length (bp)1651
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 2.2E-08 80 123
PF00569 ZZ Zinc finger, ZZ type 1.4E-08 18 59
PF04433 SWIRM SWIRM domain 9.2E-07 446 515

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59WH0|ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=1 19 518 1.0E-126
sp|Q02336|ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADA2 PE=1 SV=1 18 515 2.0E-118
sp|Q9P7J7|ADA2_SCHPO Transcriptional adapter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ada2 PE=1 SV=1 18 516 5.0E-108
sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana GN=ADA2B PE=1 SV=1 8 513 5.0E-54
sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidopsis thaliana GN=ADA2A PE=1 SV=1 8 513 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59WH0|ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=1 19 518 1.0E-126
sp|Q02336|ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADA2 PE=1 SV=1 18 515 2.0E-118
sp|Q9P7J7|ADA2_SCHPO Transcriptional adapter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ada2 PE=1 SV=1 18 516 5.0E-108
sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana GN=ADA2B PE=1 SV=1 8 513 5.0E-54
sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidopsis thaliana GN=ADA2A PE=1 SV=1 8 513 1.0E-42
sp|Q3SZP8|TAD2A_BOVIN Transcriptional adapter 2-alpha OS=Bos taurus GN=TADA2A PE=2 SV=1 21 518 3.0E-41
sp|O75478|TAD2A_HUMAN Transcriptional adapter 2-alpha OS=Homo sapiens GN=TADA2A PE=1 SV=3 21 518 2.0E-40
sp|Q6AYE3|TAD2A_RAT Transcriptional adapter 2-alpha OS=Rattus norvegicus GN=Tada2a PE=2 SV=1 21 518 2.0E-40
sp|Q75LL6|TADA2_ORYSJ Transcriptional adapter ADA2 OS=Oryza sativa subsp. japonica GN=ADA2 PE=2 SV=2 19 509 2.0E-40
sp|Q8CHV6|TAD2A_MOUSE Transcriptional adapter 2-alpha OS=Mus musculus GN=Tada2a PE=1 SV=1 21 518 3.0E-40
sp|Q5ZJF3|TAD2A_CHICK Transcriptional adapter 2-alpha OS=Gallus gallus GN=TADA2A PE=2 SV=1 21 518 1.0E-37
sp|Q5RBN9|TAD2B_PONAB Transcriptional adapter 2-beta OS=Pongo abelii GN=TADA2B PE=2 SV=1 13 367 1.0E-31
sp|Q86TJ2|TAD2B_HUMAN Transcriptional adapter 2-beta OS=Homo sapiens GN=TADA2B PE=1 SV=2 13 367 1.0E-31
sp|Q6NRB5|TAD2B_XENLA Transcriptional adapter 2-beta OS=Xenopus laevis GN=tada2b PE=2 SV=1 18 367 1.0E-30
sp|Q503N9|TAD2B_DANRE Transcriptional adapter 2-beta OS=Danio rerio GN=tada2b PE=2 SV=1 16 347 3.0E-23
sp|Q8I8V0|TAD2B_DROME Transcriptional adapter 2B OS=Drosophila melanogaster GN=Ada2b PE=1 SV=1 17 405 2.0E-21
sp|Q7KSD8|TAD2A_DROME Transcriptional adapter 2A OS=Drosophila melanogaster GN=Rpb4 PE=1 SV=1 21 517 3.0E-17
sp|P43609|RSC8_YEAST Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC8 PE=1 SV=1 19 128 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8628
MGVIRKKTVTRGGEGGVKYVCDVCSSDITSTVRIRCADPACSDFDLCVSCFAKGESRNAHDPATHPFRVIEQNSF
PIFDSEWGADEELLLLEGAEIYGLGSWADIADHIGGFREKDEVRDHYLDTYVRSNRFPLPARCSPYDSELANQVP
REEFQARKKRRIEERRERAKNAPALQPKTKPTASVPSCHEIQGYMPGRLEFETEYANEAEEAVQHMQFDPGDGLN
PRTGEMEPEMELKLTVMEIYNCRLTQRVERKKVIFEHDLLDYRENTKVEKKRNKEEKELLQKAKPFARIMNHKDF
EDFNQGLVDELNLRQAITQLQEWRGLRIGDLRSGERFETEKAQRAQKSIPMGSMDRERLASSQRSKQPPPPEAPS
GAALLVAPELAIRPASQANGEANGEAKPASNGQANGVEGVNGHGAAARPRQMPQPIAGVQPLPLSQDNAPDLHLL
TPEEAKLCEVVRLQPKPYLMIKEQILKEALKSNGTLKKKQAKDICRLDSQKGARIFDFFINAGWVGKA*
Coding >Hirsu2|8628
ATGGGTGTCATACGCAAAAAGACGGTGACGAGGGGGGGCGAGGGAGGTGTCAAATACGTATGCGACGTCTGCTCG
TCGGACATTACCTCAACGGTCCGCATTAGGTGTGCAGACCCGGCATGTTCCGACTTCGACCTGTGCGTCTCTTGC
TTCGCCAAAGGCGAGTCTCGCAACGCCCACGACCCGGCGACGCATCCCTTCCGCGTCATCGAACAGAACTCGTTC
CCCATCTTCGACTCGGAATGGGGCGCCGACGAGGAGCTCCTGCTCCTGGAAGGCGCCGAGATCTACGGCCTGGGC
TCGTGGGCCGACATCGCGGATCACATTGGGGGCTTCCGCGAAAAGGACGAGGTCCGCGACCACTACCTCGACACG
TACGTCCGCTCAAACAGGTTTCCCCTGCCGGCGAGATGCAGCCCCTACGACTCGGAGCTCGCGAACCAGGTGCCC
CGCGAGGAGTTCCAGGCCCGGAAGAAGCGGCGGATAGAGGAGCGGCGCGAGAGGGCCAAGAACGCGCCGGCGCTG
CAGCCCAAGACGAAGCCGACGGCCAGCGTGCCGTCCTGCCACGAGATCCAGGGCTACATGCCCGGCCGGCTCGAG
TTCGAGACGGAATACGCCAACGAGGCGGAGGAGGCGGTGCAGCACATGCAGTTCGACCCCGGCGACGGCCTCAAC
CCGCGCACCGGCGAGATGGAGCCCGAGATGGAGCTGAAACTGACCGTCATGGAGATCTACAACTGCCGGCTGACG
CAGCGCGTCGAGCGCAAAAAGGTCATCTTCGAGCACGACCTGCTCGACTACCGAGAGAACACCAAGGTGGAGAAG
AAGCGGAACAAGGAGGAGAAGGAGCTGCTGCAGAAGGCCAAGCCGTTCGCGCGCATCATGAACCACAAGGACTTT
GAAGACTTCAACCAGGGCCTCGTCGACGAGCTGAACCTGAGGCAGGCCATCACGCAGCTGCAGGAGTGGCGCGGC
CTGCGCATCGGCGACCTGCGGAGCGGCGAACGCTTCGAGACGGAGAAGGCGCAGCGGGCGCAGAAGTCGATCCCG
ATGGGCTCCATGGATAGGGAGCGCCTCGCCTCGAGCCAGCGTTCCAAGCAGCCGCCGCCGCCCGAGGCGCCGAGC
GGGGCGGCGCTGCTGGTCGCGCCGGAGCTCGCGATCCGGCCGGCGTCGCAGGCCAACGGCGAGGCCAACGGCGAG
GCCAAGCCGGCGAGCAACGGCCAGGCCAACGGCGTCGAGGGCGTCAACGGCCACGGCGCGGCGGCGAGGCCCCGG
CAGATGCCGCAGCCCATCGCCGGGGTGCAGCCGCTGCCGCTGAGCCAGGACAACGCGCCGGACCTGCACCTGCTG
ACGCCGGAGGAGGCCAAGCTGTGCGAGGTGGTGCGGCTGCAGCCGAAGCCGTACCTCATGATCAAGGAGCAGATC
CTCAAGGAAGCTCTCAAGTCCAACGGCACCCTCAAGAAGAAGCAGGCCAAGGACATCTGCCGGTTAGACTCGCAG
AAGGGCGCGCGGATATTCGACTTTTTCATCAATGCCGGCTGGGTGGGTAAGGCCTGA
Transcript >Hirsu2|8628
ATGGGTGTCATACGCAAAAAGACGGTGACGAGGGGGGGCGAGGGAGGTGTCAAATACGTATGCGACGTCTGCTCG
TCGGACATTACCTCAACGGTCCGCATTAGGTGTGCAGACCCGGCATGTTCCGACTTCGACCTGTGCGTCTCTTGC
TTCGCCAAAGGCGAGTCTCGCAACGCCCACGACCCGGCGACGCATCCCTTCCGCGTCATCGAACAGAACTCGTTC
CCCATCTTCGACTCGGAATGGGGCGCCGACGAGGAGCTCCTGCTCCTGGAAGGCGCCGAGATCTACGGCCTGGGC
TCGTGGGCCGACATCGCGGATCACATTGGGGGCTTCCGCGAAAAGGACGAGGTCCGCGACCACTACCTCGACACG
TACGTCCGCTCAAACAGGTTTCCCCTGCCGGCGAGATGCAGCCCCTACGACTCGGAGCTCGCGAACCAGGTGCCC
CGCGAGGAGTTCCAGGCCCGGAAGAAGCGGCGGATAGAGGAGCGGCGCGAGAGGGCCAAGAACGCGCCGGCGCTG
CAGCCCAAGACGAAGCCGACGGCCAGCGTGCCGTCCTGCCACGAGATCCAGGGCTACATGCCCGGCCGGCTCGAG
TTCGAGACGGAATACGCCAACGAGGCGGAGGAGGCGGTGCAGCACATGCAGTTCGACCCCGGCGACGGCCTCAAC
CCGCGCACCGGCGAGATGGAGCCCGAGATGGAGCTGAAACTGACCGTCATGGAGATCTACAACTGCCGGCTGACG
CAGCGCGTCGAGCGCAAAAAGGTCATCTTCGAGCACGACCTGCTCGACTACCGAGAGAACACCAAGGTGGAGAAG
AAGCGGAACAAGGAGGAGAAGGAGCTGCTGCAGAAGGCCAAGCCGTTCGCGCGCATCATGAACCACAAGGACTTT
GAAGACTTCAACCAGGGCCTCGTCGACGAGCTGAACCTGAGGCAGGCCATCACGCAGCTGCAGGAGTGGCGCGGC
CTGCGCATCGGCGACCTGCGGAGCGGCGAACGCTTCGAGACGGAGAAGGCGCAGCGGGCGCAGAAGTCGATCCCG
ATGGGCTCCATGGATAGGGAGCGCCTCGCCTCGAGCCAGCGTTCCAAGCAGCCGCCGCCGCCCGAGGCGCCGAGC
GGGGCGGCGCTGCTGGTCGCGCCGGAGCTCGCGATCCGGCCGGCGTCGCAGGCCAACGGCGAGGCCAACGGCGAG
GCCAAGCCGGCGAGCAACGGCCAGGCCAACGGCGTCGAGGGCGTCAACGGCCACGGCGCGGCGGCGAGGCCCCGG
CAGATGCCGCAGCCCATCGCCGGGGTGCAGCCGCTGCCGCTGAGCCAGGACAACGCGCCGGACCTGCACCTGCTG
ACGCCGGAGGAGGCCAAGCTGTGCGAGGTGGTGCGGCTGCAGCCGAAGCCGTACCTCATGATCAAGGAGCAGATC
CTCAAGGAAGCTCTCAAGTCCAACGGCACCCTCAAGAAGAAGCAGGCCAAGGACATCTGCCGGTTAGACTCGCAG
AAGGGCGCGCGGATATTCGACTTTTTCATCAATGCCGGCTGGGTGGGTAAGGCCTGA
Gene >Hirsu2|8628
ATGGGTGTCATACGCAAAAAGACGGTGACGAGGGGGGGCGAGGGAGGTGTCAAATACGTATGCGACGTCTGCTCG
TCGGACATTACCTCAACGGTACGTGTCGGGCCGACTGCCCACGCCCGCGCCCGCGACGCTCTCTCTGCTTCCCTT
TGGCCCGGCCGATGGGCTCATTCGTCGCGTCTTGTAGGTCCGCATTAGGTGTGCAGACCCGGCATGTTCCGACTT
CGACCTGTGCGTCTCTTGCTTCGCCAAAGGCGAGTCTCGCAACGCCCACGACCCGGCGACGCATCCCTTCCGCGT
CATCGAACAGAACTCGTTCCCCATCTTCGACTCGGAATGGGGCGCCGACGAGGAGCTCCTGCTCCTGGAAGGCGC
CGAGATCTACGGCCTGGGCTCGTGGGCCGACATCGCGGATCACATTGGGGGCTTCCGCGAAAAGGACGAGGTCCG
CGACCACTACCTCGACACGTACGTCCGCTCAAACAGGTTTCCCCTGCCGGCGAGATGCAGCCCCTACGACTCGGA
GCTCGCGAACCAGGTGCCCCGCGAGGAGTTCCAGGCCCGGAAGAAGCGGCGGATAGAGGAGCGGCGCGAGAGGGC
CAAGAACGCGCCGGCGCTGCAGCCCAAGACGAAGCCGACGGCCAGCGTGCCGTCCTGCCACGAGATCCAGGGCTA
CATGCCCGGCCGGCTCGAGTTCGAGACGGAATACGCCAACGAGGCGGAGGAGGCGGTGCAGCACATGCAGTTCGA
CCCCGGCGACGGCCTCAACCCGCGCACCGGCGAGATGGAGCCCGAGATGGAGCTGAAACTGACCGTCATGGAGAT
CTACAACTGCCGGCTGACGCAGCGCGTCGAGCGCAAAAAGGTCATCTTCGAGCACGACCTGCTCGACTACCGAGA
GAACACCAAGGTGGAGAAGAAGCGGAACAAGGAGGAGAAGGAGCTGCTGCAGAAGGCCAAGCCGTTCGCGCGCAT
CATGAACCACAAGGACTTTGAAGACTTCAACCAGGGCCTCGTCGACGAGCTGAACCTGAGGCAGGCCATCACGCA
GCTGCAGGAGTGGCGCGGCCTGCGCATCGGCGACCTGCGGAGCGGCGAACGCTTCGAGACGGAGAAGGCGCAGCG
GGCGCAGAAGTCGATCCCGATGGGCTCCATGGATAGGGAGCGCCTCGCCTCGAGCCAGCGTTCCAAGCAGCCGCC
GCCGCCCGAGGCGCCGAGCGGGGCGGCGCTGCTGGTCGCGCCGGAGCTCGCGATCCGGCCGGCGTCGCAGGCCAA
CGGCGAGGCCAACGGCGAGGCCAAGCCGGCGAGCAACGGCCAGGCCAACGGCGTCGAGGGCGTCAACGGCCACGG
CGCGGCGGCGAGGCCCCGGCAGATGCCGCAGCCCATCGCCGGGGTGCAGCCGCTGCCGCTGAGCCAGGACAACGC
GCCGGACCTGCACCTGCTGACGCCGGAGGAGGCCAAGCTGTGCGAGGTGGTGCGGCTGCAGCCGAAGCCGTACCT
CATGATCAAGGAGCAGATCCTCAAGGAAGCTCTCAAGTCCAACGGCACCCTCAAGAAGAAGCAGGCCAAGGACAT
CTGCCGGTTAGACTCGCAGAAGGGCGCGCGGATATTCGACTTTTTCATCAATGCCGGCTGGGTGGGTAAGGCCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail