Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8621
Gene name
LocationContig_575:5909..7558
Strand+
Gene length (bp)1649
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature 9.6E-20 34 80
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 4.6E-15 154 221
PF08544 GHMP_kinases_C GHMP kinases C terminal 5.2E-14 421 489

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P09608|GAL1_KLULA Galactokinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL1 PE=2 SV=2 22 518 2.0E-124
sp|P04385|GAL1_YEAST Galactokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL1 PE=1 SV=4 30 520 2.0E-118
sp|Q9HDU2|GAL1_SCHPO Galactokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal1 PE=3 SV=1 21 517 3.0E-116
sp|O42821|GAL1_CANPA Galactokinase OS=Candida parapsilosis GN=GAL1 PE=3 SV=1 4 521 7.0E-113
sp|P56091|GAL1_CANAX Galactokinase OS=Candida albicans GN=GAL1 PE=3 SV=1 25 517 2.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P09608|GAL1_KLULA Galactokinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL1 PE=2 SV=2 22 518 2.0E-124
sp|P04385|GAL1_YEAST Galactokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL1 PE=1 SV=4 30 520 2.0E-118
sp|Q9HDU2|GAL1_SCHPO Galactokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal1 PE=3 SV=1 21 517 3.0E-116
sp|O42821|GAL1_CANPA Galactokinase OS=Candida parapsilosis GN=GAL1 PE=3 SV=1 4 521 7.0E-113
sp|P56091|GAL1_CANAX Galactokinase OS=Candida albicans GN=GAL1 PE=3 SV=1 25 517 2.0E-107
sp|P13045|GAL3_YEAST Protein GAL3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL3 PE=1 SV=2 30 518 2.0E-105
sp|Q54DN6|GALK_DICDI Galactokinase OS=Dictyostelium discoideum GN=galK PE=3 SV=1 7 517 5.0E-95
sp|Q9SEE5|GALK1_ARATH Galactokinase OS=Arabidopsis thaliana GN=GAL1 PE=1 SV=2 4 520 4.0E-85
sp|Q5XIG6|GALK2_RAT N-acetylgalactosamine kinase OS=Rattus norvegicus GN=Galk2 PE=2 SV=1 22 518 6.0E-84
sp|Q68FH4|GALK2_MOUSE N-acetylgalactosamine kinase OS=Mus musculus GN=Galk2 PE=1 SV=1 22 518 2.0E-82
sp|Q5R6J8|GALK2_PONAB N-acetylgalactosamine kinase OS=Pongo abelii GN=GALK2 PE=2 SV=1 22 517 4.0E-82
sp|Q01415|GALK2_HUMAN N-acetylgalactosamine kinase OS=Homo sapiens GN=GALK2 PE=1 SV=1 22 517 1.0E-81
sp|P56599|GAL1_CANMA Galactokinase (Fragment) OS=Candida maltosa GN=GAL1 PE=3 SV=1 26 229 5.0E-38
sp|Q97EZ6|GAL1_CLOAB Galactokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=galK PE=3 SV=1 34 491 2.0E-21
sp|Q836P0|GAL1_ENTFA Galactokinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=galK PE=3 SV=1 28 491 2.0E-20
sp|B9LFE4|GAL1_CHLSY Galactokinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=galK PE=3 SV=1 30 243 4.0E-20
sp|A9WB97|GAL1_CHLAA Galactokinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=galK PE=3 SV=1 30 243 4.0E-20
sp|P57899|GAL1_PASMU Galactokinase OS=Pasteurella multocida (strain Pm70) GN=galK PE=3 SV=1 21 491 1.0E-16
sp|B4F0A6|GAL1_PROMH Galactokinase OS=Proteus mirabilis (strain HI4320) GN=galK PE=3 SV=1 34 285 2.0E-16
sp|B8F7C7|GAL1_HAEPS Galactokinase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=galK PE=3 SV=1 34 491 3.0E-16
sp|A5UZX0|GAL1_ROSS1 Galactokinase OS=Roseiflexus sp. (strain RS-1) GN=galK PE=3 SV=1 34 280 3.0E-16
sp|B7NNH9|GAL1_ECO7I Galactokinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=galK PE=3 SV=1 28 243 4.0E-15
sp|A6VQK2|GAL1_ACTSZ Galactokinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=galK PE=3 SV=1 34 491 4.0E-15
sp|B7LK02|GAL1_ESCF3 Galactokinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=galK PE=3 SV=1 28 243 6.0E-15
sp|B6I7R1|GAL1_ECOSE Galactokinase OS=Escherichia coli (strain SE11) GN=galK PE=3 SV=1 28 243 6.0E-15
sp|P0A6T3|GAL1_ECOLI Galactokinase OS=Escherichia coli (strain K12) GN=galK PE=1 SV=2 28 243 6.0E-15
sp|B1IXX9|GAL1_ECOLC Galactokinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=galK PE=3 SV=1 28 243 6.0E-15
sp|C4ZXS8|GAL1_ECOBW Galactokinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=galK PE=3 SV=1 28 243 6.0E-15
sp|B7M6C0|GAL1_ECO8A Galactokinase OS=Escherichia coli O8 (strain IAI1) GN=galK PE=3 SV=1 28 243 6.0E-15
sp|B5YRF5|GAL1_ECO5E Galactokinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=galK PE=3 SV=1 28 243 6.0E-15
sp|P0A6T4|GAL1_ECO57 Galactokinase OS=Escherichia coli O157:H7 GN=galK PE=3 SV=2 28 243 6.0E-15
sp|B7LAF8|GAL1_ECO55 Galactokinase OS=Escherichia coli (strain 55989 / EAEC) GN=galK PE=3 SV=1 28 243 6.0E-15
sp|A7ZJD2|GAL1_ECO24 Galactokinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=galK PE=3 SV=1 28 243 6.0E-15
sp|Q32IG8|GAL1_SHIDS Galactokinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=galK PE=3 SV=1 28 243 6.0E-15
sp|A7ZY13|GAL1_ECOHS Galactokinase OS=Escherichia coli O9:H4 (strain HS) GN=galK PE=3 SV=1 28 243 6.0E-15
sp|B7MPP1|GAL1_ECO81 Galactokinase OS=Escherichia coli O81 (strain ED1a) GN=galK PE=3 SV=1 28 243 7.0E-15
sp|Q1REH4|GAL1_ECOUT Galactokinase OS=Escherichia coli (strain UTI89 / UPEC) GN=galK PE=3 SV=1 28 243 7.0E-15
sp|Q8FJS1|GAL1_ECOL6 Galactokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galK PE=3 SV=3 28 243 7.0E-15
sp|Q0TJU4|GAL1_ECOL5 Galactokinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=galK PE=3 SV=1 28 243 7.0E-15
sp|A1A900|GAL1_ECOK1 Galactokinase OS=Escherichia coli O1:K1 / APEC GN=galK PE=3 SV=1 28 243 7.0E-15
sp|B7MGL4|GAL1_ECO45 Galactokinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=galK PE=3 SV=1 28 243 7.0E-15
sp|Q324G2|GAL1_SHIBS Galactokinase OS=Shigella boydii serotype 4 (strain Sb227) GN=galK PE=3 SV=1 28 243 7.0E-15
sp|Q3Z453|GAL1_SHISS Galactokinase OS=Shigella sonnei (strain Ss046) GN=galK PE=3 SV=1 28 243 7.0E-15
sp|Q83M01|GAL1_SHIFL Galactokinase OS=Shigella flexneri GN=galK PE=3 SV=3 28 243 7.0E-15
sp|B3W7I5|GAL1_LACCB Galactokinase OS=Lactobacillus casei (strain BL23) GN=galK PE=3 SV=1 33 217 7.0E-15
sp|Q0T6Y7|GAL1_SHIF8 Galactokinase OS=Shigella flexneri serotype 5b (strain 8401) GN=galK PE=3 SV=1 28 243 7.0E-15
sp|O84902|GAL1_LACCA Galactokinase OS=Lactobacillus casei GN=galK PE=3 SV=1 33 217 8.0E-15
sp|Q03BB8|GAL1_LACC3 Galactokinase OS=Lactobacillus casei (strain ATCC 334) GN=galK PE=3 SV=1 33 217 9.0E-15
sp|B7N9Z9|GAL1_ECOLU Galactokinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=galK PE=3 SV=1 28 243 1.0E-14
sp|A7NI09|GAL1_ROSCS Galactokinase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=galK PE=3 SV=1 30 284 1.0E-14
sp|B7ULN0|GAL1_ECO27 Galactokinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=galK PE=3 SV=1 28 243 2.0E-14
sp|C4LB24|GAL1_TOLAT Galactokinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=galK PE=3 SV=1 28 284 2.0E-14
sp|B2TUY8|GAL1_SHIB3 Galactokinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=galK PE=3 SV=1 28 243 2.0E-14
sp|B1LM48|GAL1_ECOSM Galactokinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=galK PE=3 SV=1 28 243 2.0E-14
sp|Q9KRP1|GAL1_VIBCH Galactokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=galK PE=3 SV=2 34 226 5.0E-14
sp|B2G9P6|GAL1_LACRJ Galactokinase OS=Lactobacillus reuteri (strain JCM 1112) GN=galK PE=3 SV=1 28 289 5.0E-14
sp|A5VME2|GAL1_LACRD Galactokinase OS=Lactobacillus reuteri (strain DSM 20016) GN=galK PE=3 SV=1 28 289 5.0E-14
sp|B9K9C8|GAL1_THENN Galactokinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=galK PE=3 SV=1 46 229 1.0E-13
sp|O85253|GAL1_THENE Galactokinase OS=Thermotoga neapolitana GN=galK PE=3 SV=1 46 229 1.0E-13
sp|P56838|GAL1_THEMA Galactokinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=galK PE=3 SV=1 46 229 1.0E-13
sp|A9MTL0|GAL1_SALPB Galactokinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=galK PE=3 SV=1 28 243 1.0E-13
sp|B7IDE2|GAL1_THEAB Galactokinase OS=Thermosipho africanus (strain TCF52B) GN=galK PE=3 SV=1 46 229 1.0E-13
sp|Q8R8R7|GAL1_CALS4 Galactokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=galK PE=3 SV=1 48 230 1.0E-13
sp|B5BC50|GAL1_SALPK Galactokinase OS=Salmonella paratyphi A (strain AKU_12601) GN=galK PE=3 SV=1 28 243 2.0E-13
sp|Q5PG77|GAL1_SALPA Galactokinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=galK PE=3 SV=1 28 243 2.0E-13
sp|B5R741|GAL1_SALG2 Galactokinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=galK PE=3 SV=1 28 243 2.0E-13
sp|B5F052|GAL1_SALA4 Galactokinase OS=Salmonella agona (strain SL483) GN=galK PE=3 SV=1 28 243 2.0E-13
sp|Q8Z8B0|GAL1_SALTI Galactokinase OS=Salmonella typhi GN=galK PE=3 SV=1 28 243 2.0E-13
sp|B4TQR9|GAL1_SALSV Galactokinase OS=Salmonella schwarzengrund (strain CVM19633) GN=galK PE=3 SV=1 28 243 2.0E-13
sp|B5QX45|GAL1_SALEP Galactokinase OS=Salmonella enteritidis PT4 (strain P125109) GN=galK PE=3 SV=1 28 243 2.0E-13
sp|B5FP41|GAL1_SALDC Galactokinase OS=Salmonella dublin (strain CT_02021853) GN=galK PE=3 SV=1 28 243 2.0E-13
sp|B4TC28|GAL1_SALHS Galactokinase OS=Salmonella heidelberg (strain SL476) GN=galK PE=3 SV=1 28 243 2.0E-13
sp|P22713|GAL1_SALTY Galactokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galK PE=3 SV=2 28 243 2.0E-13
sp|B4SZH7|GAL1_SALNS Galactokinase OS=Salmonella newport (strain SL254) GN=galK PE=3 SV=1 28 243 2.0E-13
sp|Q0TQU5|GAL1_CLOP1 Galactokinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=galK PE=3 SV=1 30 229 3.0E-13
sp|Q8XKP9|GAL1_CLOPE Galactokinase OS=Clostridium perfringens (strain 13 / Type A) GN=galK PE=3 SV=1 30 229 3.0E-13
sp|A9MJI2|GAL1_SALAR Galactokinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=galK PE=3 SV=1 28 243 4.0E-13
sp|P39574|GAL1_BACSU Galactokinase OS=Bacillus subtilis (strain 168) GN=galK PE=3 SV=1 48 230 4.0E-13
sp|Q8DBN9|GAL1_VIBVU Galactokinase OS=Vibrio vulnificus (strain CMCP6) GN=galK PE=3 SV=1 34 263 4.0E-13
sp|Q0ST92|GAL1_CLOPS Galactokinase OS=Clostridium perfringens (strain SM101 / Type A) GN=galK PE=3 SV=1 30 229 4.0E-13
sp|B5ETC9|GAL1_VIBFM Galactokinase OS=Vibrio fischeri (strain MJ11) GN=galK PE=3 SV=1 29 229 4.0E-13
sp|B8GCS2|GAL1_CHLAD Galactokinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=galK PE=3 SV=1 30 243 5.0E-13
sp|Q87M60|GAL1_VIBPA Galactokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=galK PE=3 SV=1 28 263 8.0E-13
sp|Q9K3S8|GAL1_STRCO Galactokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=galK PE=3 SV=1 34 368 9.0E-13
sp|Q57RI3|GAL1_SALCH Galactokinase OS=Salmonella choleraesuis (strain SC-B67) GN=galK PE=3 SV=1 28 243 1.0E-12
sp|A8AJ37|GAL1_CITK8 Galactokinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=galK PE=3 SV=1 28 243 1.0E-12
sp|B1YIH8|GAL1_EXIS2 Galactokinase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=galK PE=3 SV=1 34 285 1.0E-12
sp|Q7MI80|GAL1_VIBVY Galactokinase OS=Vibrio vulnificus (strain YJ016) GN=galK PE=3 SV=1 34 263 1.0E-12
sp|Q5E0M1|GAL1_VIBF1 Galactokinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=galK PE=3 SV=1 29 229 1.0E-12
sp|C0PWW2|GAL1_SALPC Galactokinase OS=Salmonella paratyphi C (strain RKS4594) GN=galK PE=3 SV=1 28 243 1.0E-12
sp|B2GEP6|GAL1_LACF3 Galactokinase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=galK PE=3 SV=1 28 289 1.0E-12
sp|A0KQH8|GAL1_AERHH Galactokinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=galK PE=3 SV=1 28 258 2.0E-12
sp|Q9KDV4|GAL1_BACHD Galactokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=galK PE=3 SV=1 23 232 2.0E-12
sp|A7MV01|GAL1_VIBCB Galactokinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=galK PE=3 SV=1 34 263 3.0E-12
sp|A4VT88|GAL1_STRSY Galactokinase OS=Streptococcus suis (strain 05ZYH33) GN=galK PE=3 SV=1 28 289 3.0E-12
sp|B1LCQ5|GAL1_THESQ Galactokinase OS=Thermotoga sp. (strain RQ2) GN=galK PE=3 SV=1 46 229 3.0E-12
sp|A5IMZ6|GAL1_THEP1 Galactokinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=galK PE=3 SV=1 46 229 3.0E-12
sp|A8GBA5|GAL1_SERP5 Galactokinase OS=Serratia proteamaculans (strain 568) GN=galK PE=3 SV=1 34 243 4.0E-12
sp|A4W899|GAL1_ENT38 Galactokinase OS=Enterobacter sp. (strain 638) GN=galK PE=3 SV=1 34 240 5.0E-12
sp|Q8RHD0|GAL1_FUSNN Galactokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=galK PE=3 SV=1 28 285 6.0E-12
sp|A7MIX5|GAL1_CROS8 Galactokinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=galK PE=3 SV=1 28 240 6.0E-12
sp|A6H768|GALK1_BOVIN Galactokinase OS=Bos taurus GN=GALK1 PE=2 SV=2 354 508 8.0E-12
sp|Q9GKK4|GALK1_CANLF Galactokinase OS=Canis lupus familiaris GN=GALK1 PE=2 SV=1 354 508 8.0E-12
sp|P9WN63|GAL1_MYCTU Galactokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=galK PE=3 SV=1 354 489 9.0E-12
sp|P9WN62|GAL1_MYCTO Galactokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=galK PE=3 SV=1 354 489 9.0E-12
sp|A5U003|GAL1_MYCTA Galactokinase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=galK PE=3 SV=1 354 489 9.0E-12
sp|C1AKV1|GAL1_MYCBT Galactokinase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=galK PE=3 SV=1 354 489 9.0E-12
sp|A1KG98|GAL1_MYCBP Galactokinase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=galK PE=3 SV=1 354 489 9.0E-12
sp|Q7U1L7|GAL1_MYCBO Galactokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=galK PE=3 SV=1 354 489 9.0E-12
sp|A5UZX0|GAL1_ROSS1 Galactokinase OS=Roseiflexus sp. (strain RS-1) GN=galK PE=3 SV=1 384 491 1.0E-11
sp|A7NI09|GAL1_ROSCS Galactokinase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=galK PE=3 SV=1 384 492 1.0E-11
sp|A1JRX5|GAL1_YERE8 Galactokinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=galK PE=3 SV=1 32 284 1.0E-11
sp|B1JST8|GAL1_YERPY Galactokinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=galK PE=3 SV=1 34 284 2.0E-11
sp|A4TNR8|GAL1_YERPP Galactokinase OS=Yersinia pestis (strain Pestoides F) GN=galK PE=3 SV=1 34 284 2.0E-11
sp|Q1CFP0|GAL1_YERPN Galactokinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=galK PE=3 SV=1 34 284 2.0E-11
sp|A9R3B5|GAL1_YERPG Galactokinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=galK PE=3 SV=1 34 284 2.0E-11
sp|Q8ZGY3|GAL1_YERPE Galactokinase OS=Yersinia pestis GN=galK PE=3 SV=1 34 284 2.0E-11
sp|Q1C960|GAL1_YERPA Galactokinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=galK PE=3 SV=1 34 284 2.0E-11
sp|A7FKP2|GAL1_YERP3 Galactokinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=galK PE=3 SV=1 34 284 2.0E-11
sp|Q66D80|GAL1_YERPS Galactokinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=galK PE=3 SV=1 34 284 3.0E-11
sp|B2K8R6|GAL1_YERPB Galactokinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=galK PE=3 SV=1 34 284 3.0E-11
sp|A6M1P8|GAL1_CLOB8 Galactokinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=galK PE=3 SV=1 30 229 5.0E-11
sp|B2VBV2|GAL1_ERWT9 Galactokinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=galK PE=3 SV=1 34 243 6.0E-11
sp|Q8R8R7|GAL1_CALS4 Galactokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=galK PE=3 SV=1 384 491 1.0E-10
sp|Q9GKK4|GALK1_CANLF Galactokinase OS=Canis lupus familiaris GN=GALK1 PE=2 SV=1 34 273 1.0E-10
sp|P13227|GAL1_STRLI Galactokinase OS=Streptomyces lividans GN=galK PE=3 SV=2 383 499 2.0E-10
sp|Q65UV5|GAL1_MANSM Galactokinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=galK PE=3 SV=1 386 491 2.0E-10
sp|Q9K3S8|GAL1_STRCO Galactokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=galK PE=3 SV=1 383 497 3.0E-10
sp|Q896X8|GAL1_CLOTE Galactokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=galK PE=3 SV=1 34 285 3.0E-10
sp|P51570|GALK1_HUMAN Galactokinase OS=Homo sapiens GN=GALK1 PE=1 SV=1 354 491 3.0E-10
sp|Q9R0N0|GALK1_MOUSE Galactokinase OS=Mus musculus GN=Galk1 PE=1 SV=2 26 229 5.0E-10
sp|Q9R0N0|GALK1_MOUSE Galactokinase OS=Mus musculus GN=Galk1 PE=1 SV=2 354 509 8.0E-10
sp|P51570|GALK1_HUMAN Galactokinase OS=Homo sapiens GN=GALK1 PE=1 SV=1 34 229 1.0E-09
sp|Q00052|GAL1_LACHE Galactokinase OS=Lactobacillus helveticus GN=galK PE=3 SV=1 28 289 2.0E-09
sp|Q9RGS1|GAL1_STACT Galactokinase OS=Staphylococcus carnosus (strain TM300) GN=galK PE=3 SV=1 46 289 2.0E-09
sp|Q65UV5|GAL1_MANSM Galactokinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=galK PE=3 SV=1 34 284 3.0E-09
sp|Q9HHB6|GAL1_PYRFU Galactokinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=galK PE=1 SV=1 422 493 3.0E-09
sp|Q1WUZ4|GAL1_LACS1 Galactokinase OS=Lactobacillus salivarius (strain UCC118) GN=galK PE=3 SV=1 34 289 3.0E-09
sp|Q8RHD0|GAL1_FUSNN Galactokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=galK PE=3 SV=1 358 480 4.0E-09
sp|Q88SE8|GAL1_LACPL Galactokinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=galK PE=3 SV=1 34 230 4.0E-09
sp|B0BPT5|GAL1_ACTPJ Galactokinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=galK PE=3 SV=1 34 284 4.0E-09
sp|B0BPT5|GAL1_ACTPJ Galactokinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=galK PE=3 SV=1 377 491 4.0E-09
sp|Q5LYY7|GAL1_STRT1 Galactokinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=galK PE=3 SV=1 29 289 4.0E-09
sp|Q9ZB10|GAL1_STRTR Galactokinase OS=Streptococcus thermophilus GN=galK PE=3 SV=1 29 289 4.0E-09
sp|Q03JS8|GAL1_STRTD Galactokinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=galK PE=3 SV=1 29 289 6.0E-09
sp|P31767|GAL1_HAEIN Galactokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galK PE=3 SV=2 386 491 6.0E-09
sp|B2VBV2|GAL1_ERWT9 Galactokinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=galK PE=3 SV=1 386 493 7.0E-09
sp|A6H768|GALK1_BOVIN Galactokinase OS=Bos taurus GN=GALK1 PE=2 SV=2 34 273 9.0E-09
sp|P9WN63|GAL1_MYCTU Galactokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=galK PE=3 SV=1 48 285 9.0E-09
sp|P9WN62|GAL1_MYCTO Galactokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=galK PE=3 SV=1 48 285 9.0E-09
sp|A5U003|GAL1_MYCTA Galactokinase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=galK PE=3 SV=1 48 285 9.0E-09
sp|B3H1M3|GAL1_ACTP7 Galactokinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=galK PE=3 SV=1 386 491 9.0E-09
sp|A9MTL0|GAL1_SALPB Galactokinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|B5BC50|GAL1_SALPK Galactokinase OS=Salmonella paratyphi A (strain AKU_12601) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|Q5PG77|GAL1_SALPA Galactokinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|B5R741|GAL1_SALG2 Galactokinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|B5F052|GAL1_SALA4 Galactokinase OS=Salmonella agona (strain SL483) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|Q8Z8B0|GAL1_SALTI Galactokinase OS=Salmonella typhi GN=galK PE=3 SV=1 362 493 1.0E-08
sp|B4TQR9|GAL1_SALSV Galactokinase OS=Salmonella schwarzengrund (strain CVM19633) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|B5QX45|GAL1_SALEP Galactokinase OS=Salmonella enteritidis PT4 (strain P125109) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|B5FP41|GAL1_SALDC Galactokinase OS=Salmonella dublin (strain CT_02021853) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|B4TC28|GAL1_SALHS Galactokinase OS=Salmonella heidelberg (strain SL476) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|Q57RI3|GAL1_SALCH Galactokinase OS=Salmonella choleraesuis (strain SC-B67) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|C0PWW2|GAL1_SALPC Galactokinase OS=Salmonella paratyphi C (strain RKS4594) GN=galK PE=3 SV=1 362 493 1.0E-08
sp|Q9RGS1|GAL1_STACT Galactokinase OS=Staphylococcus carnosus (strain TM300) GN=galK PE=3 SV=1 384 491 1.0E-08
sp|Q5LYY7|GAL1_STRT1 Galactokinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=galK PE=3 SV=1 386 491 1.0E-08
sp|Q9ZB10|GAL1_STRTR Galactokinase OS=Streptococcus thermophilus GN=galK PE=3 SV=1 386 491 1.0E-08
sp|B3H1M3|GAL1_ACTP7 Galactokinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=galK PE=3 SV=1 34 284 1.0E-08
sp|A3N103|GAL1_ACTP2 Galactokinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=galK PE=3 SV=1 34 284 1.0E-08
sp|A3N103|GAL1_ACTP2 Galactokinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=galK PE=3 SV=1 377 491 1.0E-08
sp|P94169|GAL1_ACTPL Galactokinase OS=Actinobacillus pleuropneumoniae GN=galK PE=3 SV=1 386 491 1.0E-08
sp|Q49ZK2|GAL1_STAS1 Galactokinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=galK PE=3 SV=1 34 215 1.0E-08
sp|P22713|GAL1_SALTY Galactokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galK PE=3 SV=2 362 493 2.0E-08
sp|B4SZH7|GAL1_SALNS Galactokinase OS=Salmonella newport (strain SL254) GN=galK PE=3 SV=1 362 493 2.0E-08
sp|A9MJI2|GAL1_SALAR Galactokinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=galK PE=3 SV=1 386 493 2.0E-08
sp|Q87M60|GAL1_VIBPA Galactokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=galK PE=3 SV=1 354 497 2.0E-08
sp|C1AKV1|GAL1_MYCBT Galactokinase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=galK PE=3 SV=1 48 285 2.0E-08
sp|A1KG98|GAL1_MYCBP Galactokinase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=galK PE=3 SV=1 48 285 2.0E-08
sp|Q7U1L7|GAL1_MYCBO Galactokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=galK PE=3 SV=1 48 285 2.0E-08
sp|P94169|GAL1_ACTPL Galactokinase OS=Actinobacillus pleuropneumoniae GN=galK PE=3 SV=1 34 284 3.0E-08
sp|P96993|GAL1_STRMU Galactokinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=galK PE=3 SV=2 26 289 3.0E-08
sp|P96993|GAL1_STRMU Galactokinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=galK PE=3 SV=2 354 491 3.0E-08
sp|A5UHX0|GAL1_HAEIG Galactokinase OS=Haemophilus influenzae (strain PittGG) GN=galK PE=3 SV=1 386 491 3.0E-08
sp|A5UDQ5|GAL1_HAEIE Galactokinase OS=Haemophilus influenzae (strain PittEE) GN=galK PE=3 SV=1 354 491 3.0E-08
sp|A6M1P8|GAL1_CLOB8 Galactokinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=galK PE=3 SV=1 374 491 4.0E-08
sp|B7NNH9|GAL1_ECO7I Galactokinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|B7LK02|GAL1_ESCF3 Galactokinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|B6I7R1|GAL1_ECOSE Galactokinase OS=Escherichia coli (strain SE11) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|P0A6T3|GAL1_ECOLI Galactokinase OS=Escherichia coli (strain K12) GN=galK PE=1 SV=2 386 493 5.0E-08
sp|B1IXX9|GAL1_ECOLC Galactokinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|C4ZXS8|GAL1_ECOBW Galactokinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|B7M6C0|GAL1_ECO8A Galactokinase OS=Escherichia coli O8 (strain IAI1) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|B5YRF5|GAL1_ECO5E Galactokinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|P0A6T4|GAL1_ECO57 Galactokinase OS=Escherichia coli O157:H7 GN=galK PE=3 SV=2 386 493 5.0E-08
sp|B7LAF8|GAL1_ECO55 Galactokinase OS=Escherichia coli (strain 55989 / EAEC) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|A7ZJD2|GAL1_ECO24 Galactokinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|Q324G2|GAL1_SHIBS Galactokinase OS=Shigella boydii serotype 4 (strain Sb227) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|Q3Z453|GAL1_SHISS Galactokinase OS=Shigella sonnei (strain Ss046) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|Q83M01|GAL1_SHIFL Galactokinase OS=Shigella flexneri GN=galK PE=3 SV=3 386 493 5.0E-08
sp|B7N9Z9|GAL1_ECOLU Galactokinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|B7ULN0|GAL1_ECO27 Galactokinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|B2TUY8|GAL1_SHIB3 Galactokinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|B1LM48|GAL1_ECOSM Galactokinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=galK PE=3 SV=1 386 493 5.0E-08
sp|Q8DBN9|GAL1_VIBVU Galactokinase OS=Vibrio vulnificus (strain CMCP6) GN=galK PE=3 SV=1 354 508 5.0E-08
sp|Q7MI80|GAL1_VIBVY Galactokinase OS=Vibrio vulnificus (strain YJ016) GN=galK PE=3 SV=1 354 508 5.0E-08
sp|B7MPP1|GAL1_ECO81 Galactokinase OS=Escherichia coli O81 (strain ED1a) GN=galK PE=3 SV=1 386 493 6.0E-08
sp|P39574|GAL1_BACSU Galactokinase OS=Bacillus subtilis (strain 168) GN=galK PE=3 SV=1 385 482 6.0E-08
sp|C4LB24|GAL1_TOLAT Galactokinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=galK PE=3 SV=1 354 491 7.0E-08
sp|B4F0A6|GAL1_PROMH Galactokinase OS=Proteus mirabilis (strain HI4320) GN=galK PE=3 SV=1 354 491 9.0E-08
sp|A4W899|GAL1_ENT38 Galactokinase OS=Enterobacter sp. (strain 638) GN=galK PE=3 SV=1 362 493 9.0E-08
sp|B5ETC9|GAL1_VIBFM Galactokinase OS=Vibrio fischeri (strain MJ11) GN=galK PE=3 SV=1 354 493 1.0E-07
sp|A8AJ37|GAL1_CITK8 Galactokinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=galK PE=3 SV=1 365 493 1.0E-07
sp|Q5E0M1|GAL1_VIBF1 Galactokinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=galK PE=3 SV=1 354 493 1.0E-07
sp|Q03JS8|GAL1_STRTD Galactokinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=galK PE=3 SV=1 386 491 1.0E-07
sp|Q32IG8|GAL1_SHIDS Galactokinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=galK PE=3 SV=1 390 493 2.0E-07
sp|Q1REH4|GAL1_ECOUT Galactokinase OS=Escherichia coli (strain UTI89 / UPEC) GN=galK PE=3 SV=1 386 493 2.0E-07
sp|Q8FJS1|GAL1_ECOL6 Galactokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galK PE=3 SV=3 386 493 2.0E-07
sp|Q0TJU4|GAL1_ECOL5 Galactokinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=galK PE=3 SV=1 386 493 2.0E-07
sp|A1A900|GAL1_ECOK1 Galactokinase OS=Escherichia coli O1:K1 / APEC GN=galK PE=3 SV=1 386 493 2.0E-07
sp|B7MGL4|GAL1_ECO45 Galactokinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=galK PE=3 SV=1 386 493 2.0E-07
sp|A7MV01|GAL1_VIBCB Galactokinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=galK PE=3 SV=1 354 493 2.0E-07
sp|Q97NZ6|GAL1_STRPN Galactokinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=galK PE=3 SV=1 386 491 2.0E-07
sp|A7ZY13|GAL1_ECOHS Galactokinase OS=Escherichia coli O9:H4 (strain HS) GN=galK PE=3 SV=1 386 493 3.0E-07
sp|A7MIX5|GAL1_CROS8 Galactokinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=galK PE=3 SV=1 386 493 3.0E-07
sp|Q9R7D7|GAL1_LACLA Galactokinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=galK PE=1 SV=1 422 491 3.0E-07
sp|Q03PA8|GAL1_LACBA Galactokinase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=galK PE=3 SV=1 48 230 3.0E-07
sp|Q9S6S2|GAL1_LACLM Galactokinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=galK PE=3 SV=1 422 491 3.0E-07
sp|Q0T6Y7|GAL1_SHIF8 Galactokinase OS=Shigella flexneri serotype 5b (strain 8401) GN=galK PE=3 SV=1 386 493 4.0E-07
sp|A4VT88|GAL1_STRSY Galactokinase OS=Streptococcus suis (strain 05ZYH33) GN=galK PE=3 SV=1 354 491 4.0E-07
sp|Q5JEK8|GAL1_THEKO Galactokinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=galK PE=3 SV=1 48 251 5.0E-07
sp|A5UDQ5|GAL1_HAEIE Galactokinase OS=Haemophilus influenzae (strain PittEE) GN=galK PE=3 SV=1 48 284 1.0E-06
sp|O58107|GAL1_PYRHO Galactokinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=galK PE=1 SV=1 348 492 1.0E-06
sp|B1YIH8|GAL1_EXIS2 Galactokinase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=galK PE=3 SV=1 377 491 2.0E-06
sp|P31767|GAL1_HAEIN Galactokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galK PE=3 SV=2 48 284 2.0E-06
sp|A5UHX0|GAL1_HAEIG Galactokinase OS=Haemophilus influenzae (strain PittGG) GN=galK PE=3 SV=1 48 285 2.0E-06
sp|Q8DNK7|GAL1_STRR6 Galactokinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=galK PE=3 SV=1 354 491 2.0E-06
sp|Q97NZ6|GAL1_STRPN Galactokinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=galK PE=3 SV=1 22 217 4.0E-06
sp|Q5JEK8|GAL1_THEKO Galactokinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=galK PE=3 SV=1 354 475 4.0E-06
sp|B8GCS2|GAL1_CHLAD Galactokinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=galK PE=3 SV=1 422 521 5.0E-06
sp|Q66D80|GAL1_YERPS Galactokinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=galK PE=3 SV=1 421 491 8.0E-06
sp|B2K8R6|GAL1_YERPB Galactokinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=galK PE=3 SV=1 421 491 8.0E-06
sp|A0KQH8|GAL1_AERHH Galactokinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=galK PE=3 SV=1 422 491 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0005534 galactose binding Yes
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030246 carbohydrate binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0048029 monosaccharide binding No
GO:0032555 purine ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8621
MSGSVPVATALADIYPPAALPAESARWERLLAGFRDAYGRPASFVARSPGRVNIIGEHIDYSLYSVLPMAITADA
LLAVAARPAAADAAAFTLRLANVQGSRFEPSEFRVPAQGDVDIDATRFDWTNYFKSGLRGALGLLRRKRGPSWTP
CDMDVLMDGNVPVGGGLSSSAAFVSASALAVLVANGVAPVDKKELTELAIVSERAVGVNSGGMDQAASVFSEQGS
ALFVSFSPGLAARPVRFPPTRPELCFVVAQSFVTSNKQVTGPIHYNLRVVEVSLAAAYLNAVLNPPGTELPLDAG
PLGTSLQGFHDAFFLLRAGSDYAAAKTLSKEEELEKLVALTEETLTQEQGYTKEEVAKVLGLSTPELEKRFLSSF
PVRAERFKLRQRALHVFTEALRVLRFLTLLERPLHTGATDTSDFNRRLGALMNETQDSCRELYECSCPEIDRICR
VAREAGAYGSRLTGAGWGGCSVHLVPADRVADVKEALERDYFAGKELTREQRDGAVVVSRPAGGSAVYHVEGQGV
RER*
Coding >Hirsu2|8621
ATGTCCGGATCGGTGCCGGTCGCGACGGCCCTCGCCGACATCTACCCTCCTGCCGCCCTGCCGGCCGAGTCGGCG
CGGTGGGAGAGGCTGCTGGCCGGCTTCCGGGACGCCTACGGCCGGCCGGCCAGCTTCGTCGCCCGCTCGCCCGGC
CGCGTCAACATCATCGGCGAGCACATCGACTACTCGCTCTACTCGGTCCTGCCAATGGCCATCACCGCCGACGCG
CTCCTCGCTGTCGCCGCCCGCCCGGCCGCCGCCGACGCCGCCGCCTTCACCCTCCGCCTGGCCAACGTGCAGGGC
TCCCGCTTCGAGCCGAGCGAGTTCCGCGTGCCGGCCCAGGGCGACGTCGACATCGACGCCACCAGGTTCGACTGG
ACAAACTACTTCAAGAGCGGCCTCCGTGGCGCCCTGGGCCTGCTGCGGCGCAAGCGCGGCCCGTCCTGGACGCCC
TGCGACATGGACGTCCTGATGGACGGCAACGTCCCCGTCGGCGGCGGCCTGAGCTCCAGCGCCGCCTTCGTCAGC
GCCAGCGCCCTCGCCGTCCTCGTCGCCAACGGCGTCGCGCCCGTCGACAAGAAGGAGTTGACGGAGCTGGCCATC
GTCAGCGAGCGTGCCGTCGGCGTCAACTCGGGCGGCATGGACCAGGCCGCCTCCGTCTTCTCCGAGCAGGGCTCC
GCCCTCTTCGTCTCCTTCAGCCCCGGCCTCGCGGCCCGGCCCGTCAGGTTCCCGCCGACTCGGCCGGAGCTGTGC
TTCGTCGTCGCCCAGAGCTTCGTCACGTCCAACAAGCAGGTCACGGGCCCGATCCACTACAACCTCCGCGTCGTC
GAGGTCAGCCTCGCGGCCGCCTACCTCAACGCCGTCCTCAACCCGCCCGGCACGGAGCTGCCCCTGGACGCCGGC
CCGCTCGGCACCAGCCTGCAGGGCTTCCACGACGCCTTCTTCCTGCTCCGGGCCGGCTCCGACTACGCCGCGGCC
AAGACGCTCAGCAAGGAGGAGGAGCTGGAAAAGCTGGTGGCGCTGACGGAGGAGACGCTGACGCAGGAGCAGGGC
TACACCAAGGAGGAGGTGGCCAAGGTGCTGGGCCTGTCGACGCCGGAGCTCGAGAAGCGCTTCCTCTCGAGCTTC
CCCGTGCGGGCCGAACGCTTCAAGCTCCGCCAGCGGGCGCTGCACGTCTTCACGGAGGCGCTGCGCGTGCTCCGG
TTCCTGACCCTGCTCGAGCGGCCGCTGCACACGGGCGCGACGGACACGAGCGACTTCAACCGCCGGCTCGGGGCG
CTCATGAACGAGACGCAAGACTCGTGCAGGGAGCTGTACGAATGCAGCTGCCCCGAGATCGACCGCATCTGCCGA
GTGGCGCGCGAGGCCGGCGCCTACGGGAGCCGGCTGACGGGGGCCGGCTGGGGCGGGTGCAGCGTGCACCTGGTG
CCGGCGGACAGGGTGGCCGACGTCAAGGAGGCGCTGGAGCGCGACTACTTTGCCGGCAAGGAGCTGACGCGGGAG
CAGAGGGACGGCGCCGTCGTGGTGAGCCGGCCGGCGGGCGGGAGCGCCGTCTATCACGTCGAGGGGCAAGGCGTT
CGCGAGCGTTGA
Transcript >Hirsu2|8621
ATGTCCGGATCGGTGCCGGTCGCGACGGCCCTCGCCGACATCTACCCTCCTGCCGCCCTGCCGGCCGAGTCGGCG
CGGTGGGAGAGGCTGCTGGCCGGCTTCCGGGACGCCTACGGCCGGCCGGCCAGCTTCGTCGCCCGCTCGCCCGGC
CGCGTCAACATCATCGGCGAGCACATCGACTACTCGCTCTACTCGGTCCTGCCAATGGCCATCACCGCCGACGCG
CTCCTCGCTGTCGCCGCCCGCCCGGCCGCCGCCGACGCCGCCGCCTTCACCCTCCGCCTGGCCAACGTGCAGGGC
TCCCGCTTCGAGCCGAGCGAGTTCCGCGTGCCGGCCCAGGGCGACGTCGACATCGACGCCACCAGGTTCGACTGG
ACAAACTACTTCAAGAGCGGCCTCCGTGGCGCCCTGGGCCTGCTGCGGCGCAAGCGCGGCCCGTCCTGGACGCCC
TGCGACATGGACGTCCTGATGGACGGCAACGTCCCCGTCGGCGGCGGCCTGAGCTCCAGCGCCGCCTTCGTCAGC
GCCAGCGCCCTCGCCGTCCTCGTCGCCAACGGCGTCGCGCCCGTCGACAAGAAGGAGTTGACGGAGCTGGCCATC
GTCAGCGAGCGTGCCGTCGGCGTCAACTCGGGCGGCATGGACCAGGCCGCCTCCGTCTTCTCCGAGCAGGGCTCC
GCCCTCTTCGTCTCCTTCAGCCCCGGCCTCGCGGCCCGGCCCGTCAGGTTCCCGCCGACTCGGCCGGAGCTGTGC
TTCGTCGTCGCCCAGAGCTTCGTCACGTCCAACAAGCAGGTCACGGGCCCGATCCACTACAACCTCCGCGTCGTC
GAGGTCAGCCTCGCGGCCGCCTACCTCAACGCCGTCCTCAACCCGCCCGGCACGGAGCTGCCCCTGGACGCCGGC
CCGCTCGGCACCAGCCTGCAGGGCTTCCACGACGCCTTCTTCCTGCTCCGGGCCGGCTCCGACTACGCCGCGGCC
AAGACGCTCAGCAAGGAGGAGGAGCTGGAAAAGCTGGTGGCGCTGACGGAGGAGACGCTGACGCAGGAGCAGGGC
TACACCAAGGAGGAGGTGGCCAAGGTGCTGGGCCTGTCGACGCCGGAGCTCGAGAAGCGCTTCCTCTCGAGCTTC
CCCGTGCGGGCCGAACGCTTCAAGCTCCGCCAGCGGGCGCTGCACGTCTTCACGGAGGCGCTGCGCGTGCTCCGG
TTCCTGACCCTGCTCGAGCGGCCGCTGCACACGGGCGCGACGGACACGAGCGACTTCAACCGCCGGCTCGGGGCG
CTCATGAACGAGACGCAAGACTCGTGCAGGGAGCTGTACGAATGCAGCTGCCCCGAGATCGACCGCATCTGCCGA
GTGGCGCGCGAGGCCGGCGCCTACGGGAGCCGGCTGACGGGGGCCGGCTGGGGCGGGTGCAGCGTGCACCTGGTG
CCGGCGGACAGGGTGGCCGACGTCAAGGAGGCGCTGGAGCGCGACTACTTTGCCGGCAAGGAGCTGACGCGGGAG
CAGAGGGACGGCGCCGTCGTGGTGAGCCGGCCGGCGGGCGGGAGCGCCGTCTATCACGTCGAGGGGCAAGGCGTT
CGCGAGCGTTGA
Gene >Hirsu2|8621
ATGTCCGGATCGGTGCCGGTCGCGACGGCCCTCGCCGACATCTACCCTCCTGCCGCCCTGCCGGCCGAGTCGGCG
CGGTGGGAGAGGCTGCTGGCCGGCTTCCGGGACGCCTACGGCCGGCCGGCCAGCTTCGTCGCCCGCTCGCCCGGC
CGCGTCAACATCATCGGCGAGCACATCGACTACTCGCTCTACTCGGTCCTGCCAATGGCCATCACCGCCGACGCG
CTCCTCGCTGTCGCCGCCCGCCCGGCCGCCGCCGACGCCGCCGCCTTCACCCTCCGCCTGGCCAACGTGCAGGGC
TCCCGCTTCGAGCCGAGCGAGTTCCGCGTGCCGGCCCAGGGCGACGTCGACATCGACGCCACCAGGTTCGACTGG
ACAAACTACTTCAAGAGCGGCCTCCGTGGCGCCCTGGGCCTGCTGCGGCGCAAGCGCGGCCCGTCCTGGACGCCC
TGCGACATGGACGTCCTGATGGACGGCAACGTCCCCGTCGGCGGCGGCCTGAGCTCCAGCGCCGCCTTCGTCAGC
GCCAGCGCCCTCGCCGTCCTCGTCGCCAACGGCGTCGCGCCCGTCGACAAGAAGGAGTTGACGGAGCTGGCCATC
GTCAGCGAGCGTGCCGTCGGCGTCAACTCGGGCGGGTGAGAGCCGTGCCTGCCCTTATCCCGTCTCGTCTGCTGA
CGCACACACCGCGCCTCTGCAGCATGGACCAGGCCGCCTCCGTCTTCTCCGAGCAGGGCTCCGCCCTCTTCGTCT
CCTTCAGCCCCGGCCTCGCGGCCCGGCCCGTCAGGTTCCCGCCGACTCGGCCGGAGCTGTGCTTCGTCGTCGCCC
AGAGCTTCGTCACGTCCAACAAGCAGGTCACGGGCCCGATCCACTACAACCTCCGCGTCGTCGAGGTCAGCCTCG
CGGCCGCCTACCTCAACGCCGTCCTCAACCCGCCCGGCACGGAGCTGCCCCTGGACGCCGGCCCGCTCGGCACCA
GCCTGCAGGGCTTCCACGACGCCTTCTTCCTGCTCCGGGCCGGCTCCGACTACGCCGCGGCCAAGACGCTCAGCA
AGGAGGAGGAGCTGGAAAAGCTGGTGGCGCTGACGGAGGAGACGCTGACGCAGGAGCAGGGCTACACCAAGGAGG
AGGTGGCCAAGGTGCTGGGCCTGTCGACGCCGGAGCTCGAGAAGCGCTTCCTCTCGAGCTTCCCCGTGCGGGCCG
AACGCTTCAAGCTCCGCCAGCGGGCGCTGCACGTCTTCACGGAGGCGCTGCGCGTGCTCCGGTTCCTGACCCTGC
TCGAGCGGCCGCTGCACACGGGCGCGACGGACACGAGCGACTTCAACCGCCGGCTCGGGGCGCTCATGAACGAGA
CGCAAGACTCGTGCAGGGAGCTGTACGAATGCAGCTGCCCCGAGATCGACCGCATCTGCCGAGTGGCGCGCGAGG
CCGGCGCCTACGGGAGCCGGCTGACGGGGGCCGGCTGGGGCGGGTGCAGCGTGCACCTGGTGCCGGCGGACAGGG
TGGCCGACGTCAAGGAGGCGCTGGAGCGCGACTACTTTGCCGGCAAGGAGCTGACGCGGGAGCAGAGGGACGGCG
CCGTCGTGGTGAGCCGGCCGGCGGGCGGGAGCGCCGTCTATCACGTCGAGGGGCAAGGCGTTCGCGAGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail