Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|862
Gene name
LocationContig_118:32284..33723
Strand-
Gene length (bp)1439
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4492 0.769 0.4399 0.091 0.0758 0.0351 0.1103 0.0348 0.1025 0.0061

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1351
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03813
Ophiocordyceps camponoti-rufipedis Ophun1|5825
Ophiocordyceps subramaniannii Hirsu2|10756
Ophiocordyceps subramaniannii Hirsu2|2981
Ophiocordyceps subramaniannii Hirsu2|3370
Ophiocordyceps subramaniannii Hirsu2|3900
Ophiocordyceps subramaniannii Hirsu2|862 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|862
MNQEKLREWLSQVRAPVTTGAQAQPEPESAAGPSKPNMEKCQKGVGEKLKRDRDAIMGKEGNKAATEALVKQSIC
SLSKPSTSNQPPPSKKAKGAETSESSAEDRLAALPSPDPQAIEACGASLDDILKALSSQELPAWLRDEEAAAREL
CEYIDVASLYVDTVITSNNEDEAPSLHEPRPGHTAWDQFLRGVQEQFNIGGDRLQEVLSRGVEHLQRALPQVYDY
MQQNYPELPNVITEMIRLGYTIVTCVAGNQPASKPMLRARAERPPLCDKFFAALHTRNGGGGGGNANKDSLQQRL
RADNFTGLDCAAALATVLKQSGLGEADAKGDKWPPQTPSLFLAARCRLRKRSLLTAIIFFPIKGGTNDDCQRARA
IVTPKSRKRPEAGDDTTRGSMPPPAGLPCGSIDKLEFQLELSSGAGDGTYDAILAGFEPGLTALKTGEIRAKDPA
AKKLL*
Coding >Hirsu2|862
ATGAACCAGGAAAAACTACGCGAATGGCTCTCCCAGGTTCGAGCTCCGGTCACCACCGGCGCTCAGGCGCAGCCG
GAGCCGGAGTCCGCCGCAGGGCCAAGCAAACCGAATATGGAGAAGTGCCAGAAAGGGGTCGGCGAGAAACTGAAA
AGGGATCGGGATGCGATCATGGGCAAGGAGGGGAATAAGGCCGCGACCGAGGCATTGGTAAAGCAGTCTATCTGC
TCGTTAAGCAAGCCGTCGACGTCGAACCAGCCACCGCCGTCAAAGAAGGCCAAGGGCGCCGAAACCTCTGAATCG
TCTGCAGAGGACAGACTCGCAGCCTTGCCGAGCCCTGACCCTCAGGCCATCGAAGCCTGTGGAGCGTCTTTGGAC
GACATACTCAAGGCCTTGTCGTCCCAAGAACTGCCCGCCTGGTTGAGAGATGAGGAGGCCGCTGCCAGAGAACTA
TGCGAGTACATCGACGTGGCTAGCCTGTATGTCGACACTGTCATTACAAGCAACAACGAGGACGAGGCGCCGTCG
TTGCACGAGCCACGACCGGGCCACACGGCATGGGACCAGTTTCTCCGGGGCGTTCAGGAGCAGTTCAATATAGGC
GGGGACCGGCTCCAGGAGGTCTTGAGCCGCGGTGTGGAGCACCTACAAAGGGCCTTACCCCAAGTCTATGACTAC
ATGCAGCAAAATTATCCCGAGCTCCCTAACGTTATTACGGAAATGATCCGCTTGGGTTATACTATCGTTACCTGC
GTGGCTGGGAACCAGCCAGCATCAAAGCCGATGCTTAGAGCCCGGGCCGAGCGACCGCCCTTATGCGATAAGTTC
TTTGCCGCCTTACATACACGCAACGGCGGCGGCGGCGGCGGCAACGCGAATAAAGACTCGCTCCAGCAGCGCCTA
AGGGCCGACAACTTTACCGGGCTAGATTGTGCCGCCGCCCTCGCTACCGTTCTTAAGCAATCTGGCCTTGGAGAG
GCCGACGCAAAAGGTGACAAGTGGCCACCCCAAACCCCCTCCTTGTTTCTCGCGGCGCGCTGCCGGCTCCGCAAG
AGGTCGTTGCTAACCGCCATCATCTTCTTCCCTATTAAAGGAGGTACCAACGACGACTGCCAGCGTGCCCGGGCC
ATAGTTACGCCTAAGAGTCGCAAGAGGCCCGAGGCCGGTGACGATACCACACGTGGGTCTATGCCGCCGCCCGCA
GGCCTACCCTGCGGCTCCATCGATAAGCTTGAGTTCCAGCTTGAGCTTTCGAGCGGCGCGGGAGACGGGACATAT
GACGCTATCCTTGCCGGCTTTGAACCGGGATTAACCGCGCTCAAGACGGGCGAGATTCGTGCGAAGGATCCAGCG
GCTAAGAAGCTTCTATAG
Transcript >Hirsu2|862
ATGAACCAGGAAAAACTACGCGAATGGCTCTCCCAGGTTCGAGCTCCGGTCACCACCGGCGCTCAGGCGCAGCCG
GAGCCGGAGTCCGCCGCAGGGCCAAGCAAACCGAATATGGAGAAGTGCCAGAAAGGGGTCGGCGAGAAACTGAAA
AGGGATCGGGATGCGATCATGGGCAAGGAGGGGAATAAGGCCGCGACCGAGGCATTGGTAAAGCAGTCTATCTGC
TCGTTAAGCAAGCCGTCGACGTCGAACCAGCCACCGCCGTCAAAGAAGGCCAAGGGCGCCGAAACCTCTGAATCG
TCTGCAGAGGACAGACTCGCAGCCTTGCCGAGCCCTGACCCTCAGGCCATCGAAGCCTGTGGAGCGTCTTTGGAC
GACATACTCAAGGCCTTGTCGTCCCAAGAACTGCCCGCCTGGTTGAGAGATGAGGAGGCCGCTGCCAGAGAACTA
TGCGAGTACATCGACGTGGCTAGCCTGTATGTCGACACTGTCATTACAAGCAACAACGAGGACGAGGCGCCGTCG
TTGCACGAGCCACGACCGGGCCACACGGCATGGGACCAGTTTCTCCGGGGCGTTCAGGAGCAGTTCAATATAGGC
GGGGACCGGCTCCAGGAGGTCTTGAGCCGCGGTGTGGAGCACCTACAAAGGGCCTTACCCCAAGTCTATGACTAC
ATGCAGCAAAATTATCCCGAGCTCCCTAACGTTATTACGGAAATGATCCGCTTGGGTTATACTATCGTTACCTGC
GTGGCTGGGAACCAGCCAGCATCAAAGCCGATGCTTAGAGCCCGGGCCGAGCGACCGCCCTTATGCGATAAGTTC
TTTGCCGCCTTACATACACGCAACGGCGGCGGCGGCGGCGGCAACGCGAATAAAGACTCGCTCCAGCAGCGCCTA
AGGGCCGACAACTTTACCGGGCTAGATTGTGCCGCCGCCCTCGCTACCGTTCTTAAGCAATCTGGCCTTGGAGAG
GCCGACGCAAAAGGTGACAAGTGGCCACCCCAAACCCCCTCCTTGTTTCTCGCGGCGCGCTGCCGGCTCCGCAAG
AGGTCGTTGCTAACCGCCATCATCTTCTTCCCTATTAAAGGAGGTACCAACGACGACTGCCAGCGTGCCCGGGCC
ATAGTTACGCCTAAGAGTCGCAAGAGGCCCGAGGCCGGTGACGATACCACACGTGGGTCTATGCCGCCGCCCGCA
GGCCTACCCTGCGGCTCCATCGATAAGCTTGAGTTCCAGCTTGAGCTTTCGAGCGGCGCGGGAGACGGGACATAT
GACGCTATCCTTGCCGGCTTTGAACCGGGATTAACCGCGCTCAAGACGGGCGAGATTCGTGCGAAGGATCCAGCG
GCTAAGAAGCTTCTATAG
Gene >Hirsu2|862
ATGAACCAGGAAAAACTACGCGAATGGCTCTCCCAGGTTCGAGCTCCGGTCACCACCGGCGCTCAGGCGCAGCCG
GAGCCGGAGTCCGCCGCAGGGCCAAGCAAACCGAATATGGAGAAGTGCCAGAAAGGGGTCGGCGAGAAACTGAAA
AGGGATCGGGATGCGATCATGGGCAAGGAGGGGAATAAGGCCGCGACCGAGGCATTGGTAAAGCAGTCTATCTGC
TCGTTAAGCAAGCCGTCGACGTCGAACCAGCCACCGCCGTCAAAGAAGGCCAAGGGCGCCGAAACCTCTGAATCG
TCTGCAGAGGACAGACTCGCAGCCTTGCCGAGCCCTGACCCTCAGGCCATCGAAGCCTGTGGAGCGTCTTTGGAC
GACATACTCAAGGCCTTGTCGTCCCAAGAACTGCCCGCCTGGTTGAGAGATGAGGAGGCCGCTGCCAGAGAACTA
TGCGAGTACATCGACGTGGCTAGCCTGTATGTCGACACTGTCATTACAAGCAACAACGAGGACGAGGCGCCGTCG
TTGCACGGTACGCAAAGCCATTATTTCCGACCCTGGCCCCAAGCAATAAGGAGCTGACATGAAGATGACCGCTGC
CAGAGCCACGACCGGGCCACACGGCATGGGACCAGTTTCTCCGGGGCGTTCAGGAGCAGTTCAATATAGGCGGGG
ACCGGCTCCAGGAGGTCTTGAGCCGCGGTGTGGAGCACCTACAAAGGGCCTTACCCCAAGTCTATGACTACATGC
AGCAAAATTATCCCGAGCTCCCTAACGTTATTACGGAAATGATCCGCTTGGGTTATACTATCGTTACCTGCGTGG
CTGGGAACCAGCCAGCATCAAAGCCGATGCTTAGAGCCCGGGCCGAGCGACCGCCCTTATGCGATAAGTTCTTTG
CCGCCTTACATACACGCAACGGCGGCGGCGGCGGCGGCAACGCGAATAAAGACTCGCTCCAGCAGCGCCTAAGGG
CCGACAACTTTACCGGGCTAGATTGTGCCGCCGCCCTCGCTACCGTTCTTAAGCAATCTGGCCTTGGAGAGGCCG
ACGCAAAAGGTGACAAGTGGCCACCCCAAACCCCCTCCTTGTTTCTCGCGGCGCGCTGCCGGCTCCGCAAGAGGT
CGTTGCTAACCGCCATCATCTTCTTCCCTATTAAAGGAGGTACCAACGACGACTGCCAGCGTGCCCGGGCCATAG
TTACGCCTAAGAGTCGCAAGAGGCCCGAGGCCGGTGACGATACCACACGTGGGTCTATGCCGCCGCCCGCAGGCC
TACCCTGCGGCTCCATCGATAAGCTTGAGTTCCAGCTTGAGCTTTCGAGCGGCGCGGGAGACGGGACATATGACG
CTATCCTTGCCGGCTTTGAACCGGGATTAACCGCGCTCAAGACGGGCGAGATTCGTGCGAAGGATCCAGCGGCTA
AGAAGCTTCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail