Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8601
Gene name
LocationContig_571:10468..13412
Strand+
Gene length (bp)2944
Transcript length (bp)2754
Coding sequence length (bp)2754
Protein length (aa) 918

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 6.9E-69 223 391
PF08407 Chitin_synth_1N Chitin synthase N-terminal 3.9E-27 144 222
PF03142 Chitin_synth_2 Chitin synthase 2.5E-21 368 577
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.5E-06 371 595

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 1 917 0.0E+00
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 1 917 0.0E+00
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 1 917 0.0E+00
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 17 870 0.0E+00
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 110 917 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 1 917 0.0E+00
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 1 917 0.0E+00
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 1 917 0.0E+00
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 17 870 0.0E+00
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 110 917 0.0E+00
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 88 916 0.0E+00
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 5 900 0.0E+00
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 143 905 0.0E+00
sp|Q12632|CHS1_MUCCL Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus GN=CHS1 PE=3 SV=1 102 905 0.0E+00
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 140 905 0.0E+00
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 17 905 0.0E+00
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 102 905 0.0E+00
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 139 905 0.0E+00
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 9 904 0.0E+00
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 116 900 0.0E+00
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 91 905 0.0E+00
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 101 905 0.0E+00
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 145 905 0.0E+00
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 2 907 0.0E+00
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 129 900 0.0E+00
sp|P30572|CHS2_CANAX Chitin synthase 2 OS=Candida albicans GN=CHS2 PE=2 SV=2 155 905 0.0E+00
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 12 905 0.0E+00
sp|P14180|CHS2_YEAST Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS2 PE=1 SV=1 151 905 0.0E+00
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 181 900 0.0E+00
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 138 900 1.0E-168
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 140 908 5.0E-167
sp|P30577|CHS2_AJECA Chitin synthase 2 (Fragment) OS=Ajellomyces capsulatus GN=CHS2 PE=3 SV=1 228 421 1.0E-111
sp|P30593|CHS2_RHIAT Chitin synthase 2 (Fragment) OS=Rhinocladiella atrovirens GN=CHS2 PE=3 SV=1 228 421 2.0E-107
sp|P30587|CHS3_EXOJE Chitin synthase 3 (Fragment) OS=Exophiala jeanselmei GN=CHS3 PE=3 SV=1 243 421 6.0E-103
sp|O74756|CHS2_SCHPO Chitin synthase-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs2 PE=3 SV=1 53 861 1.0E-93
sp|P48017|CHS_SAPMO Chitin synthase OS=Saprolegnia monoica GN=CHS PE=3 SV=1 181 847 3.0E-92
sp|P49603|CHS1_BOTFU Chitin synthase 1 (Fragment) OS=Botryotinia fuckeliana GN=chs1 PE=3 SV=1 229 421 5.0E-59
sp|P30596|CHS1_SCHCO Chitin synthase 1 (Fragment) OS=Schizophyllum commune GN=CHS1 PE=3 SV=1 230 421 2.0E-57
sp|P30580|CHS2_AJEDE Chitin synthase 2 (Fragment) OS=Ajellomyces dermatitidis GN=CHS2 PE=3 SV=1 228 421 2.0E-55
sp|P30586|CHS2_EXOJE Chitin synthase 2 (Fragment) OS=Exophiala jeanselmei GN=CHS2 PE=3 SV=2 228 421 3.0E-55
sp|P30582|CHS2_ASPNG Chitin synthase 2 (Fragment) OS=Aspergillus niger GN=chs2 PE=3 SV=1 233 421 5.0E-55
sp|P30578|CHS3_AJECA Chitin synthase 3 (Fragment) OS=Ajellomyces capsulatus GN=CHS3 PE=3 SV=1 228 421 1.0E-54
sp|P30590|CHS1_EXOEX Chitin synthase 1 (Fragment) OS=Exophiala exophialae GN=CHS1 PE=3 SV=1 230 422 1.0E-54
sp|P30591|CHS2_EXOEX Chitin synthase 2 (Fragment) OS=Exophiala exophialae GN=CHS2 PE=3 SV=2 228 421 4.0E-54
sp|P30585|CHS1_EXOJE Chitin synthase 1 (Fragment) OS=Exophiala jeanselmei GN=CHS1 PE=3 SV=1 230 422 7.0E-54
sp|P30579|CHS1_AJEDE Chitin synthase 1 (Fragment) OS=Ajellomyces dermatitidis GN=CHS1 PE=3 SV=1 230 421 2.0E-53
sp|P30592|CHS1_RHIAT Chitin synthase 1 (Fragment) OS=Rhinocladiella atrovirens GN=CHS1 PE=3 SV=1 230 422 3.0E-53
sp|P30576|CHS1_AJECA Chitin synthase 1 (Fragment) OS=Ajellomyces capsulatus GN=CHS1 PE=3 SV=1 230 420 3.0E-53
sp|P55003|CHS1_TUBUN Chitin synthase 1 (Fragment) OS=Tuber uncinatum GN=CHS1 PE=3 SV=1 231 421 3.0E-52
sp|P30603|CHS1_XYLBA Chitin synthase 1 (Fragment) OS=Xylohypha bantiana GN=CHS1 PE=3 SV=1 230 421 1.0E-51
sp|P30581|CHS1_ASPNG Chitin synthase 1 (Fragment) OS=Aspergillus niger GN=chs1 PE=3 SV=1 230 421 2.0E-51
sp|P30604|CHS2_XYLBA Chitin synthase 2 (Fragment) OS=Xylohypha bantiana GN=CHS2 PE=3 SV=1 228 421 9.0E-49
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 368 650 2.0E-16
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 357 607 5.0E-16
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 368 601 1.0E-15
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 357 577 3.0E-15
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 368 608 4.0E-15
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 368 607 6.0E-15
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 357 601 3.0E-14
sp|Q8SSI7|CHS1_ENCCU Chitin synthase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHS1 PE=2 SV=1 368 577 5.0E-14
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 368 607 1.0E-13
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 368 601 3.0E-13
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 368 545 6.0E-13
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 365 545 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0006031 chitin biosynthetic process Yes
GO:0004100 chitin synthase activity Yes
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:0009059 macromolecule biosynthetic process No
GO:0003824 catalytic activity No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0009058 biosynthetic process No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:0006040 amino sugar metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006023 aminoglycan biosynthetic process No
GO:0006030 chitin metabolic process No
GO:0046349 amino sugar biosynthetic process No
GO:1901071 glucosamine-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006022 aminoglycan metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0017144 drug metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0008375 acetylglucosaminyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

Domain # Start End Length
1 569 591 22
2 629 651 22
3 661 683 22
4 714 736 22
5 746 768 22
6 841 863 22
7 883 905 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8601
MAYNGPGQGHGYPGGGGHPMQDLPAGGNYHLPPQDHDEEAGRYLLNEPPAVGYDHDRLGAHTPPVRPVSAYSLTE
SYAPGASPLPAAGSGGFGVNSYGQYPPDAGYGYDRPASVAGDEEESWMQRQQHPGTIGRGGGGLKRYNTRKVKLV
QGSVLSIDYPVPSAIKNAVQPCYRDVEGGNEEFMKMRYTAATCDPNDFTLKNGYDLRTRMYNRHTELLIAITYYN
EDKVLLARTLHGVMQNIRDIVNLKKSTFWNKGGPAWQKIVVCLVFDGIEKADKNTLDVLATIGIYQDGVIKKDVD
GKETVAHIFEYTSQLSVTPNQQLIRPTADSPQNLPPVQFIFCLKQKNSKKINSHRWLFNAFGRILNPEVTILIDA
GTKPSPRSLLALWEGFYNDKDLGGACGEIHAMLGKGGRKLLNPLVAVQNFEYKISNILDKPLESSFGYVSVLPGA
FSAYRFRAIMGRPLEQYFHGDHTLSKILGKKGIDGMNIFKKNMFLAEDRILCFELVAKAGQKWHLTYIKAAKGET
DVPEGAAEFISQRRRWLNGSFAASLYSLMHFGRIYKSGHNIIRMFFFHIQLIYQFLNLVFSWFSLASYYLTTTVI
MDLVGNPVVSSDPGVEHHGWPFGDTATPIINALLKYLYMAFVILQFILALGNRPKGSKFTYIASFMLFGLIQGYI
LVLSGYLVARAFTSAPLSSQISLDSGADFVRSFFSGEGAAGVILIALITIYGLYFIASFLYLDPWHMFHSFPYYM
LLMSTYINILMVYAFNNWHDVSWGTKGSDKADALPSANITKGEKNEVVVEEIEMEQEDIDSQFEQTVRRALAPFK
EVEEEEKKDVEDSYKSFRTGLVVSWLFSNIVLVIVITSDNFNSFGIGKSASVRTANFFKFLLYATAVLSLVRFFG
FLWFLGKTGIMCCFARR*
Coding >Hirsu2|8601
ATGGCGTACAACGGCCCTGGCCAGGGCCACGGCTATCCCGGCGGAGGCGGACACCCGATGCAGGACCTCCCAGCC
GGTGGCAACTATCATCTGCCGCCGCAAGATCACGACGAAGAAGCCGGTCGTTACTTGCTGAACGAGCCGCCTGCG
GTCGGATACGACCACGATAGGCTTGGAGCCCACACGCCCCCCGTCCGGCCCGTCTCTGCGTATAGCCTGACAGAG
TCGTATGCCCCAGGGGCCTCGCCGCTGCCGGCGGCTGGGTCCGGCGGCTTCGGCGTTAACTCTTACGGGCAATAC
CCACCCGACGCGGGATATGGCTACGACCGGCCCGCGTCCGTGGCCGGCGATGAGGAGGAGAGCTGGATGCAGAGG
CAGCAGCACCCCGGCACCATCGGCAGGGGCGGCGGCGGCCTGAAGCGCTACAACACGCGCAAGGTCAAGCTCGTC
CAGGGCTCCGTCCTCAGCATCGACTACCCCGTCCCCAGCGCCATCAAGAACGCGGTCCAGCCATGCTACCGCGAC
GTCGAGGGCGGCAACGAGGAGTTCATGAAGATGCGCTACACCGCCGCCACCTGCGACCCCAACGACTTCACCCTC
AAGAATGGCTACGATTTGCGGACTCGCATGTACAACCGCCACACCGAGCTGCTCATTGCCATTACGTACTACAAC
GAGGACAAGGTGCTGCTCGCCCGCACCCTGCACGGCGTCATGCAGAACATCCGCGACATCGTCAACCTCAAGAAG
TCGACCTTTTGGAACAAGGGCGGCCCGGCCTGGCAGAAGATTGTCGTCTGCCTCGTCTTCGACGGCATCGAAAAG
GCCGACAAGAACACGCTCGACGTCCTGGCCACCATTGGCATCTACCAGGACGGTGTCATCAAGAAGGACGTGGAC
GGCAAGGAGACGGTGGCCCACATCTTCGAGTACACCAGCCAGCTGTCCGTCACGCCCAACCAGCAGCTGATCCGG
CCGACGGCCGACAGCCCCCAGAACCTGCCGCCCGTCCAGTTCATCTTCTGCCTGAAGCAGAAGAACAGCAAGAAG
ATCAACTCGCACCGCTGGCTCTTCAACGCCTTCGGCCGCATCCTGAACCCCGAGGTCACCATCCTGATCGACGCC
GGCACCAAGCCGAGCCCGCGCTCCCTGCTCGCCCTGTGGGAGGGCTTCTACAACGACAAGGACCTCGGCGGCGCC
TGCGGCGAGATCCACGCCATGCTGGGCAAGGGCGGCCGGAAGCTGCTCAACCCGCTCGTCGCCGTCCAGAACTTC
GAGTACAAAATCTCCAACATCCTCGACAAGCCGCTCGAGAGCTCCTTCGGCTACGTCAGCGTCCTGCCCGGCGCC
TTCTCCGCCTACCGCTTCCGCGCCATCATGGGCCGCCCGCTCGAGCAGTACTTCCACGGCGACCACACCCTGTCC
AAGATCCTGGGCAAGAAGGGCATCGACGGCATGAACATCTTCAAGAAGAACATGTTCCTCGCCGAGGACCGCATC
CTCTGCTTCGAGCTGGTCGCCAAGGCCGGCCAGAAGTGGCACCTGACCTACATCAAGGCCGCCAAGGGCGAGACG
GACGTGCCCGAGGGCGCCGCCGAGTTCATCAGCCAGCGGCGCCGCTGGCTCAACGGCTCCTTCGCCGCCTCGCTC
TACTCCCTCATGCACTTCGGCCGCATCTACAAGAGCGGCCACAACATCATCCGCATGTTCTTCTTTCACATCCAG
CTCATCTACCAGTTCCTCAACCTCGTCTTCTCCTGGTTCTCGCTCGCGTCCTACTACCTGACGACGACGGTCATC
ATGGACCTCGTCGGCAACCCGGTCGTCTCGTCCGACCCGGGCGTCGAGCACCACGGCTGGCCCTTTGGCGACACG
GCGACGCCCATCATCAACGCCCTGCTCAAGTACCTCTACATGGCCTTTGTCATCCTGCAGTTCATCCTGGCGCTG
GGCAACCGGCCCAAGGGCTCCAAGTTCACCTACATCGCCTCCTTCATGCTCTTCGGCCTCATCCAGGGCTACATC
CTCGTGCTGTCGGGCTACCTGGTGGCGCGCGCCTTCACCAGCGCGCCGCTCTCGTCGCAGATCTCGCTCGACTCG
GGCGCCGACTTCGTGCGGAGCTTCTTCTCGGGCGAGGGCGCGGCCGGCGTCATCCTCATCGCCCTCATCACTATC
TACGGCCTGTACTTCATCGCGTCCTTCCTGTACCTCGACCCGTGGCACATGTTCCACTCGTTCCCCTACTACATG
CTGCTCATGTCGACCTACATCAACATCCTCATGGTCTACGCCTTCAACAACTGGCACGACGTCTCCTGGGGCACC
AAGGGGTCCGACAAGGCCGACGCCCTGCCGTCGGCCAACATCACCAAGGGCGAGAAGAACGAGGTGGTGGTGGAG
GAGATTGAGATGGAGCAGGAGGACATCGACAGCCAGTTCGAGCAGACGGTGCGCCGGGCCCTGGCCCCCTTCAAG
GAGGTGGAGGAGGAGGAGAAGAAGGACGTGGAGGACTCGTACAAGTCCTTCCGAACCGGCCTGGTCGTCTCCTGG
CTCTTCTCCAACATCGTGCTGGTGATTGTCATCACCAGCGACAACTTCAACTCGTTCGGCATCGGGAAATCGGCG
TCGGTGCGCACGGCCAACTTCTTCAAGTTTTTGCTGTACGCCACGGCGGTGCTGTCGCTGGTCCGCTTCTTCGGG
TTCCTCTGGTTCCTGGGCAAGACGGGCATCATGTGCTGCTTCGCGCGGAGATGA
Transcript >Hirsu2|8601
ATGGCGTACAACGGCCCTGGCCAGGGCCACGGCTATCCCGGCGGAGGCGGACACCCGATGCAGGACCTCCCAGCC
GGTGGCAACTATCATCTGCCGCCGCAAGATCACGACGAAGAAGCCGGTCGTTACTTGCTGAACGAGCCGCCTGCG
GTCGGATACGACCACGATAGGCTTGGAGCCCACACGCCCCCCGTCCGGCCCGTCTCTGCGTATAGCCTGACAGAG
TCGTATGCCCCAGGGGCCTCGCCGCTGCCGGCGGCTGGGTCCGGCGGCTTCGGCGTTAACTCTTACGGGCAATAC
CCACCCGACGCGGGATATGGCTACGACCGGCCCGCGTCCGTGGCCGGCGATGAGGAGGAGAGCTGGATGCAGAGG
CAGCAGCACCCCGGCACCATCGGCAGGGGCGGCGGCGGCCTGAAGCGCTACAACACGCGCAAGGTCAAGCTCGTC
CAGGGCTCCGTCCTCAGCATCGACTACCCCGTCCCCAGCGCCATCAAGAACGCGGTCCAGCCATGCTACCGCGAC
GTCGAGGGCGGCAACGAGGAGTTCATGAAGATGCGCTACACCGCCGCCACCTGCGACCCCAACGACTTCACCCTC
AAGAATGGCTACGATTTGCGGACTCGCATGTACAACCGCCACACCGAGCTGCTCATTGCCATTACGTACTACAAC
GAGGACAAGGTGCTGCTCGCCCGCACCCTGCACGGCGTCATGCAGAACATCCGCGACATCGTCAACCTCAAGAAG
TCGACCTTTTGGAACAAGGGCGGCCCGGCCTGGCAGAAGATTGTCGTCTGCCTCGTCTTCGACGGCATCGAAAAG
GCCGACAAGAACACGCTCGACGTCCTGGCCACCATTGGCATCTACCAGGACGGTGTCATCAAGAAGGACGTGGAC
GGCAAGGAGACGGTGGCCCACATCTTCGAGTACACCAGCCAGCTGTCCGTCACGCCCAACCAGCAGCTGATCCGG
CCGACGGCCGACAGCCCCCAGAACCTGCCGCCCGTCCAGTTCATCTTCTGCCTGAAGCAGAAGAACAGCAAGAAG
ATCAACTCGCACCGCTGGCTCTTCAACGCCTTCGGCCGCATCCTGAACCCCGAGGTCACCATCCTGATCGACGCC
GGCACCAAGCCGAGCCCGCGCTCCCTGCTCGCCCTGTGGGAGGGCTTCTACAACGACAAGGACCTCGGCGGCGCC
TGCGGCGAGATCCACGCCATGCTGGGCAAGGGCGGCCGGAAGCTGCTCAACCCGCTCGTCGCCGTCCAGAACTTC
GAGTACAAAATCTCCAACATCCTCGACAAGCCGCTCGAGAGCTCCTTCGGCTACGTCAGCGTCCTGCCCGGCGCC
TTCTCCGCCTACCGCTTCCGCGCCATCATGGGCCGCCCGCTCGAGCAGTACTTCCACGGCGACCACACCCTGTCC
AAGATCCTGGGCAAGAAGGGCATCGACGGCATGAACATCTTCAAGAAGAACATGTTCCTCGCCGAGGACCGCATC
CTCTGCTTCGAGCTGGTCGCCAAGGCCGGCCAGAAGTGGCACCTGACCTACATCAAGGCCGCCAAGGGCGAGACG
GACGTGCCCGAGGGCGCCGCCGAGTTCATCAGCCAGCGGCGCCGCTGGCTCAACGGCTCCTTCGCCGCCTCGCTC
TACTCCCTCATGCACTTCGGCCGCATCTACAAGAGCGGCCACAACATCATCCGCATGTTCTTCTTTCACATCCAG
CTCATCTACCAGTTCCTCAACCTCGTCTTCTCCTGGTTCTCGCTCGCGTCCTACTACCTGACGACGACGGTCATC
ATGGACCTCGTCGGCAACCCGGTCGTCTCGTCCGACCCGGGCGTCGAGCACCACGGCTGGCCCTTTGGCGACACG
GCGACGCCCATCATCAACGCCCTGCTCAAGTACCTCTACATGGCCTTTGTCATCCTGCAGTTCATCCTGGCGCTG
GGCAACCGGCCCAAGGGCTCCAAGTTCACCTACATCGCCTCCTTCATGCTCTTCGGCCTCATCCAGGGCTACATC
CTCGTGCTGTCGGGCTACCTGGTGGCGCGCGCCTTCACCAGCGCGCCGCTCTCGTCGCAGATCTCGCTCGACTCG
GGCGCCGACTTCGTGCGGAGCTTCTTCTCGGGCGAGGGCGCGGCCGGCGTCATCCTCATCGCCCTCATCACTATC
TACGGCCTGTACTTCATCGCGTCCTTCCTGTACCTCGACCCGTGGCACATGTTCCACTCGTTCCCCTACTACATG
CTGCTCATGTCGACCTACATCAACATCCTCATGGTCTACGCCTTCAACAACTGGCACGACGTCTCCTGGGGCACC
AAGGGGTCCGACAAGGCCGACGCCCTGCCGTCGGCCAACATCACCAAGGGCGAGAAGAACGAGGTGGTGGTGGAG
GAGATTGAGATGGAGCAGGAGGACATCGACAGCCAGTTCGAGCAGACGGTGCGCCGGGCCCTGGCCCCCTTCAAG
GAGGTGGAGGAGGAGGAGAAGAAGGACGTGGAGGACTCGTACAAGTCCTTCCGAACCGGCCTGGTCGTCTCCTGG
CTCTTCTCCAACATCGTGCTGGTGATTGTCATCACCAGCGACAACTTCAACTCGTTCGGCATCGGGAAATCGGCG
TCGGTGCGCACGGCCAACTTCTTCAAGTTTTTGCTGTACGCCACGGCGGTGCTGTCGCTGGTCCGCTTCTTCGGG
TTCCTCTGGTTCCTGGGCAAGACGGGCATCATGTGCTGCTTCGCGCGGAGATGA
Gene >Hirsu2|8601
ATGGCGTACAACGGCCCTGGCCAGGGCCACGGCTATCCCGGCGGAGGCGGACACCCGATGCAGGACCTCCCAGCC
GGTGGCAACGTGAGTGTGCGCCGCTTTGAATCTTTTTTTTTTTTCTGTTTGTTTGTATTTCTTCCCCTCCTCGGC
GGAGGGGAAACGCCAAAAAGTCAATGGCCTGCTGACGTTCTTTTCGCTGCGCCTAGTATCATCTGCCGCCGCAAG
ATCACGACGAAGAAGCCGGTCGTTACTTGCTGAACGAGCCGCCTGCGGTCGGATACGACCACGATAGGCTTGGAG
CCCACACGCCCCCCGTCCGGCCCGTCTCTGCGTATAGCCTGACAGAGTCGTATGCCCCAGGGGCCTCGCCGCTGC
CGGCGGCTGGGTCCGGCGGCTTCGGCGTTAACTCTTACGGGCAATACCCACCCGACGCGGGATATGGCTACGACC
GGCCCGCGTCCGTGGCCGGCGATGAGGAGGAGAGCTGGATGCAGAGGCAGCAGCACCCCGGCACCATCGGCAGGG
GCGGCGGCGGCCTGAAGCGCTACAACACGCGCAAGGTCAAGCTCGTCCAGGGCTCCGTCCTCAGCATCGACTACC
CCGTCCCCAGCGCCATCAAGAACGCGGTCCAGCCATGCTACCGCGACGTCGAGGGCGGCAACGAGGAGTTCATGA
AGATGCGCTACACCGCCGCCACCTGCGACCCCAACGACTTCACCCTCAAGAATGGCTACGATTTGCGGACTCGCA
TGTACAACCGCCACACCGAGCTGCTCATTGCCATTACGTACTACAACGAGGACAAGGTGCTGCTCGCCCGCACCC
TGCACGGCGTCATGCAGAACATCCGCGACATCGTCAACCTCAAGAAGTCGACCTTTTGGAACAAGGGCGGCCCGG
CCTGGCAGAAGATTGTCGTCTGCCTCGTCTTCGACGGCATCGAAAAGGCCGACAAGAACACGCTCGACGTCCTGG
CCACCATTGGCATCTACCAGGACGGTGTCATCAAGAAGGACGTGGACGGCAAGGAGACGGTGGCCCACATCTTCG
AGTACACCAGCCAGCTGTCCGTCACGCCCAACCAGCAGCTGATCCGGCCGACGGCCGACAGCCCCCAGAACCTGC
CGCCCGTCCAGTTCATCTTCTGCCTGAAGCAGAAGAACAGCAAGAAGATCAACTCGCACCGCTGGCTCTTCAACG
CCTTCGGCCGCATCCTGAACCCCGAGGTCACCATCCTGATCGACGCCGGCACCAAGCCGAGCCCGCGCTCCCTGC
TCGCCCTGTGGGAGGGCTTCTACAACGACAAGGACCTCGGCGGCGCCTGCGGCGAGATCCACGCCATGCTGGGCA
AGGGCGGCCGGAAGCTGCTCAACCCGCTCGTCGCCGTCCAGAACTTCGAGTACAAAATCTCCAACATCCTCGACA
AGCCGCTCGAGAGCTCCTTCGGCTACGTCAGCGTCCTGCCCGGCGCCTTCTCCGCCTACCGCTTCCGCGCCATCA
TGGGCCGCCCGCTCGAGCAGTACTTCCACGGCGACCACACCCTGTCCAAGATCCTGGGCAAGAAGGGCATCGACG
GCATGAACATCTTCAAGAAGAACATGTTCCTCGCCGAGGACCGCATCCTCTGCTTCGAGCTGGTCGCCAAGGCCG
GCCAGAAGTGGCACCTGACCTACATCAAGGCCGCCAAGGGCGAGACGGACGTGCCCGAGGGCGCCGCCGAGTTCA
TCAGCCAGCGGCGCCGCTGGCTCAACGGCTCCTTCGCCGCCTCGCTCTACTCCCTCATGCACTTCGGCCGCATCT
ACAAGAGCGGCCACAACATCATCCGCATGTTCTTCTTTCACATCCAGCTCATCTACCAGTTCCTCAACCTCGTCT
TCTCCTGGTTCTCGCTCGCGTCCTACTACCTGACGACGACGGTCATCATGGACCTCGTCGGCAACCCGGTCGTCT
CGTCCGACCCGGGCGTCGAGCACCACGGCTGGCCCTTTGGCGACACGGCGACGCCCATCATCAACGCCCTGCTCA
AGTACCTCTACATGGCCTTTGTCATCCTGCAGTTCATCCTGGCGCTGGGCAACCGGCCCAAGGGCTCCAAGTTCA
CCTACATCGCCTCCTTCATGCTCTTCGGCCTCATCCAGGGCTACATCCTCGTGCTGTCGGGCTACCTGGTGGCGC
GCGCCTTCACCAGCGCGCCGCTCTCGTCGCAGATCTCGCTCGACTCGGGCGCCGACTTCGTGCGGAGCTTCTTCT
CGGGCGAGGGCGCGGCCGGCGTCATCCTCATCGCCCTCATCACTATCTACGGCCTGTACTTCATCGCGTCCTTCC
TGTACCTCGACCCGTGGCACATGTTCCACTCGTTCCCCTACTACATGCTGCTCATGTCGACCTACATCAACATCC
TCATGGTCTACGCCTTCAACAACTGGCACGACGTCTCCTGGGGCACCAAGGGGTCCGACAAGGCCGACGCCCTGC
CGTCGGCCAACATCACCAAGGGCGAGAAGAACGAGGTGGTGGTGGAGGAGATTGAGATGGAGCAGGAGGACATCG
ACAGCCAGTTCGAGCAGACGGTGCGCCGGGCCCTGGCCCCCTTCAAGGAGGTGGAGGAGGAGGAGAAGAAGGACG
TGGAGGACTCGTACAAGTCCTTCCGAACCGGCCTGGTCGTCTCCTGGCTCTTCTCCAACATCGTGCTGGTGATTG
TCATCACCAGCGACAACTTCAACTCGTTCGGCATCGGGGTAAGTGGCCGCCTCCGACTTGTGCGCGGGTGCGCGC
GCAAGCAGATACTGACGGGTCGCCTCTCTAGAAATCGGCGTCGGTGCGCACGGCCAACTTCTTCAAGTTTTTGCT
GTACGCCACGGCGGTGCTGTCGCTGGTCCGCTTCTTCGGGTTCCTCTGGTTCCTGGGCAAGACGGGCATCATGTG
CTGCTTCGCGCGGAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail