Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8593
Gene name
LocationContig_570:7930..9731
Strand-
Gene length (bp)1801
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease 4.0E-13 372 477
PF08969 USP8_dimer USP8 dimerisation domain 4.2E-09 18 119
PF14464 Prok-JAB Prokaryotic homologs of the JAB domain 1.2E-05 390 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 358 550 6.0E-55
sp|Q8VYB5|AMSH1_ARATH AMSH-like ubiquitin thioesterase 1 OS=Arabidopsis thaliana GN=AMSH1 PE=2 SV=1 34 548 1.0E-45
sp|Q5PNU3|AMSH3_ARATH AMSH-like ubiquitin thioesterase 3 OS=Arabidopsis thaliana GN=AMSH3 PE=1 SV=2 25 548 3.0E-43
sp|Q6TH47|STBPA_DANRE STAM-binding protein-like A OS=Danio rerio GN=stambpa PE=2 SV=3 319 518 1.0E-41
sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens GN=STAMBP PE=1 SV=1 352 521 2.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 358 550 6.0E-55
sp|Q8VYB5|AMSH1_ARATH AMSH-like ubiquitin thioesterase 1 OS=Arabidopsis thaliana GN=AMSH1 PE=2 SV=1 34 548 1.0E-45
sp|Q5PNU3|AMSH3_ARATH AMSH-like ubiquitin thioesterase 3 OS=Arabidopsis thaliana GN=AMSH3 PE=1 SV=2 25 548 3.0E-43
sp|Q6TH47|STBPA_DANRE STAM-binding protein-like A OS=Danio rerio GN=stambpa PE=2 SV=3 319 518 1.0E-41
sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens GN=STAMBP PE=1 SV=1 352 521 2.0E-41
sp|Q54Q40|D1039_DICDI Probable ubiquitin thioesterase DG1039 OS=Dictyostelium discoideum GN=DG1039 PE=3 SV=1 310 518 2.0E-41
sp|Q63ZM7|STABP_XENLA STAM-binding protein-like OS=Xenopus laevis GN=stambp PE=2 SV=1 323 518 1.0E-40
sp|Q8R424|STABP_RAT STAM-binding protein OS=Rattus norvegicus GN=Stambp PE=2 SV=1 298 521 2.0E-39
sp|Q9CQ26|STABP_MOUSE STAM-binding protein OS=Mus musculus GN=Stambp PE=1 SV=1 298 521 2.0E-39
sp|Q96FJ0|STALP_HUMAN AMSH-like protease OS=Homo sapiens GN=STAMBPL1 PE=1 SV=2 369 519 1.0E-37
sp|Q5R558|STALP_PONAB AMSH-like protease OS=Pongo abelii GN=STAMBPL1 PE=2 SV=1 369 519 6.0E-37
sp|Q76N33|STALP_MOUSE AMSH-like protease OS=Mus musculus GN=Stambpl1 PE=1 SV=1 348 521 3.0E-36
sp|Q6NKP9|AMSH2_ARATH AMSH-like ubiquitin thioesterase 2 OS=Arabidopsis thaliana GN=AMSH2 PE=2 SV=1 371 548 2.0E-35
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 15 145 1.0E-09
sp|Q6FKA3|RFU1_CANGA Regulator of free ubiquitin chains 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RFU1 PE=3 SV=1 21 131 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0140492 metal-dependent deubiquitinase activity Yes
GO:0070122 obsolete isopeptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0008237 metallopeptidase activity No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0005488 binding No
GO:0101005 deubiquitinase activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5877 0.5481 0.1029 0.0528 0.0978 0.0021 0.0472 0.1792 0.0345 0.0071

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4210
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4525
Ophiocordyceps australis map64 (Brazil) OphauB2|7601
Ophiocordyceps camponoti-floridani Ophcf2|00541
Ophiocordyceps camponoti-rufipedis Ophun1|3384
Ophiocordyceps kimflemingae Ophio5|7644
Ophiocordyceps subramaniannii Hirsu2|8593 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8593
MEPRSPRPPPRPSRPPTISALVAQAENFTFNANIPFKHWVRAAETLHQEASFAMSDGDYGRAYWLLYRHSKLVLE
HMPSHPRYRDRDSRLMFRSLSRRIDSVLDELERLKPGLEDEYEKWEQANARPARQPSTPSAPTSPASYADFAARD
PSLYGPARVLDASEHRELAVDLARKELARRDRAKRAARAQLAPPASPTSGHAAHRDGRSLDAHEDDFRRQMEAAR
RALSLSQLSGRTEGRAAGPGGAHQPIPAPFNYPSIARSRPVDDDAAHRQRRPPAAPAPDRPPKESLAPSTSQDPS
VCTPNADGLLPAVPRKLPLEDQAGPPPPASSAPANQPPLPPKGLPVDGPPLPRRDRLTFKPGAYLENGDPIRSVF
IPSQLRSAFLDMADDNTRAGLEMCGIICGMPVNNALFVRSLIIPDQRCTSDTCETENEGAIFDYCSSEDLIVLGW
IHTHPTQTCFMSSRDLHTHAGYQVMMPESIAIVCAPRFKPSYGIFRLTHPPGLEHILDCKHQDTFHQHSIDNIYR
DSEHPGGHVYESDTLPFYVRDLRTKPTF*
Coding >Hirsu2|8593
ATGGAGCCGCGCTCGCCTCGTCCGCCGCCGCGGCCCTCGCGCCCGCCGACCATCAGCGCGCTGGTCGCCCAGGCC
GAGAACTTCACCTTCAACGCAAACATCCCGTTCAAGCACTGGGTCAGAGCGGCCGAGACGCTGCATCAAGAGGCC
TCCTTCGCCATGTCCGACGGCGACTACGGCCGTGCCTACTGGCTGCTCTATCGCCACTCGAAACTCGTCCTCGAG
CACATGCCCTCGCACCCGCGCTACAGGGACCGTGACAGCCGCCTCATGTTTCGCTCCTTGTCCCGACGCATCGAC
AGCGTCCTCGACGAACTAGAGCGCCTCAAACCCGGCCTGGAAGACGAATATGAGAAATGGGAGCAGGCCAACGCG
CGCCCCGCTCGACAGCCGAGCACGCCAAGCGCACCGACGTCGCCAGCCAGCTACGCCGACTTTGCCGCACGCGAC
CCCAGCCTGTATGGCCCTGCCCGCGTGCTCGACGCCTCGGAGCACCGCGAGCTGGCCGTTGACTTGGCCCGGAAG
GAGCTGGCGCGGAGAGATAGGGCCAAACGGGCGGCCAGGGCACAGCTTGCGCCACCTGCTTCGCCGACGAGCGGC
CACGCCGCCCACCGAGACGGTAGATCCCTAGACGCCCATGAAGATGACTTTCGTCGGCAGATGGAAGCCGCCAGG
CGCGCTTTGAGCCTCAGTCAGCTGTCGGGAAGAACAGAAGGGAGGGCGGCCGGGCCCGGTGGTGCTCACCAGCCG
ATCCCGGCTCCGTTCAATTATCCCTCGATAGCCAGGTCGAGGCCCGTCGACGACGATGCCGCCCATCGCCAGCGG
CGCCCACCCGCAGCGCCGGCGCCTGACCGGCCGCCCAAGGAGAGCCTGGCGCCGTCAACGAGCCAGGACCCGTCG
GTTTGTACCCCCAATGCCGATGGCCTGCTGCCAGCCGTTCCACGCAAACTGCCGCTGGAGGACCAAGCCGGACCT
CCTCCGCCGGCCTCCTCCGCTCCTGCTAATCAACCCCCTTTACCGCCAAAGGGACTGCCCGTGGATGGACCGCCG
CTCCCTAGGAGAGATCGGCTCACGTTTAAGCCCGGGGCGTACCTCGAGAACGGCGACCCGATCCGATCCGTCTTC
ATCCCCAGCCAGCTACGGTCGGCCTTCCTCGACATGGCCGACGACAACACGCGGGCTGGTCTGGAAATGTGCGGC
ATCATCTGCGGCATGCCGGTCAACAACGCCCTGTTCGTGCGCAGCTTGATCATTCCCGATCAGAGGTGCACGTCG
GACACGTGCGAAACAGAAAACGAAGGTGCGATATTCGACTATTGCTCCAGCGAGGATTTGATTGTTCTGGGATGG
ATCCACACGCACCCGACGCAGACGTGCTTCATGAGCTCTCGCGACTTGCACACGCACGCCGGCTACCAGGTCATG
ATGCCAGAGAGCATCGCCATCGTCTGCGCTCCCAGATTCAAGCCATCATACGGAATCTTTCGCCTCACCCATCCT
CCCGGCCTCGAACACATCCTGGACTGCAAACACCAGGATACCTTCCATCAGCATTCGATCGACAACATATATCGC
GACTCGGAGCACCCGGGTGGCCACGTCTACGAAAGCGATACCTTGCCCTTTTACGTCAGGGACCTGCGAACGAAG
CCGACATTTTAG
Transcript >Hirsu2|8593
ATGGAGCCGCGCTCGCCTCGTCCGCCGCCGCGGCCCTCGCGCCCGCCGACCATCAGCGCGCTGGTCGCCCAGGCC
GAGAACTTCACCTTCAACGCAAACATCCCGTTCAAGCACTGGGTCAGAGCGGCCGAGACGCTGCATCAAGAGGCC
TCCTTCGCCATGTCCGACGGCGACTACGGCCGTGCCTACTGGCTGCTCTATCGCCACTCGAAACTCGTCCTCGAG
CACATGCCCTCGCACCCGCGCTACAGGGACCGTGACAGCCGCCTCATGTTTCGCTCCTTGTCCCGACGCATCGAC
AGCGTCCTCGACGAACTAGAGCGCCTCAAACCCGGCCTGGAAGACGAATATGAGAAATGGGAGCAGGCCAACGCG
CGCCCCGCTCGACAGCCGAGCACGCCAAGCGCACCGACGTCGCCAGCCAGCTACGCCGACTTTGCCGCACGCGAC
CCCAGCCTGTATGGCCCTGCCCGCGTGCTCGACGCCTCGGAGCACCGCGAGCTGGCCGTTGACTTGGCCCGGAAG
GAGCTGGCGCGGAGAGATAGGGCCAAACGGGCGGCCAGGGCACAGCTTGCGCCACCTGCTTCGCCGACGAGCGGC
CACGCCGCCCACCGAGACGGTAGATCCCTAGACGCCCATGAAGATGACTTTCGTCGGCAGATGGAAGCCGCCAGG
CGCGCTTTGAGCCTCAGTCAGCTGTCGGGAAGAACAGAAGGGAGGGCGGCCGGGCCCGGTGGTGCTCACCAGCCG
ATCCCGGCTCCGTTCAATTATCCCTCGATAGCCAGGTCGAGGCCCGTCGACGACGATGCCGCCCATCGCCAGCGG
CGCCCACCCGCAGCGCCGGCGCCTGACCGGCCGCCCAAGGAGAGCCTGGCGCCGTCAACGAGCCAGGACCCGTCG
GTTTGTACCCCCAATGCCGATGGCCTGCTGCCAGCCGTTCCACGCAAACTGCCGCTGGAGGACCAAGCCGGACCT
CCTCCGCCGGCCTCCTCCGCTCCTGCTAATCAACCCCCTTTACCGCCAAAGGGACTGCCCGTGGATGGACCGCCG
CTCCCTAGGAGAGATCGGCTCACGTTTAAGCCCGGGGCGTACCTCGAGAACGGCGACCCGATCCGATCCGTCTTC
ATCCCCAGCCAGCTACGGTCGGCCTTCCTCGACATGGCCGACGACAACACGCGGGCTGGTCTGGAAATGTGCGGC
ATCATCTGCGGCATGCCGGTCAACAACGCCCTGTTCGTGCGCAGCTTGATCATTCCCGATCAGAGGTGCACGTCG
GACACGTGCGAAACAGAAAACGAAGGTGCGATATTCGACTATTGCTCCAGCGAGGATTTGATTGTTCTGGGATGG
ATCCACACGCACCCGACGCAGACGTGCTTCATGAGCTCTCGCGACTTGCACACGCACGCCGGCTACCAGGTCATG
ATGCCAGAGAGCATCGCCATCGTCTGCGCTCCCAGATTCAAGCCATCATACGGAATCTTTCGCCTCACCCATCCT
CCCGGCCTCGAACACATCCTGGACTGCAAACACCAGGATACCTTCCATCAGCATTCGATCGACAACATATATCGC
GACTCGGAGCACCCGGGTGGCCACGTCTACGAAAGCGATACCTTGCCCTTTTACGTCAGGGACCTGCGAACGAAG
CCGACATTTTAG
Gene >Hirsu2|8593
ATGGAGCCGCGCTCGCCTCGTCCGCCGCCGCGGCCCTCGCGCCCGCCGACCATCAGCGCGCTGGTCGCCCAGGCC
GAGAACTTCACCTTCAACGCAAACATCCCGTTCAAGCACTGGGTCAGAGCGGCCGAGACGCTGCATCAAGAGGTC
CAGCACCGCCCCTCCCCGTCCTCGTCTCGGCATCGAGCCGCAGCTGACAGCCGCCTCAGGCCTCCTTCGCCATGT
CCGACGGCGACTACGGCCGTGCCTACTGGCTGCTCTATCGCCACTCGAAACTCGTCCTCGAGCACATGCCCTCGC
ACCCGCGCTACAGGGACCGTGACAGCCGCCTCATGTTTCGCTCCTTGTCCCGACGCATCGACAGCGTCCTCGACG
AACTAGAGCGCCTCAAACCCGGCCTGGAAGACGAATATGAGAAATGGGAGCAGGCCAACGCGCGCCCCGCTCGAC
AGCCGAGCACGCCAAGCGCACCGACGTCGCCAGCCAGCTACGCCGACTTTGCCGCACGCGACCCCAGCCTGTATG
GCCCTGCCCGCGTGCTCGACGCCTCGGAGCACCGCGAGCTGGCCGTTGACTTGGCCCGGAAGGAGCTGGCGCGGA
GAGATAGGGCCAAACGGGCGGCCAGGGCACAGCTTGCGCCACCTGCTTCGCCGACGAGCGGCCACGCCGCCCACC
GAGACGGTAGATCCCTAGACGCCCATGAAGATGACTTTCGTCGGCAGATGGAAGCCGCCAGGCGCGCTTTGAGCC
TCAGTCAGCTGTCGGGAAGAACAGAAGGGAGGGCGGCCGGGCCCGGTGGTGCTCACCAGCCGATCCCGGCTCCGT
TCAATTATCCCTCGATAGCCAGGTCGAGGCCCGTCGACGACGATGCCGCCCATCGCCAGCGGCGCCCACCCGCAG
CGCCGGCGCCTGACCGGCCGCCCAAGGAGAGCCTGGCGCCGTCAACGAGCCAGGACCCGTCGGTTTGTACCCCCA
ATGCCGATGGCCTGCTGCCAGCCGTTCCACGCAAACTGCCGCTGGAGGACCAAGCCGGACCTCCTCCGCCGGCCT
CCTCCGCTCCTGCTAATCAACCCCCTTTACCGCCAAAGGGACTGCCCGTGGATGGACCGCCGCTCCCTAGGAGAG
ATCGGCTCACGTTTAAGCCCGGGGCGTACCTCGAGAACGGCGACCCGATCCGATCCGTCTTCATCCCCAGCCAGC
TACGGTCGGCCTTCCTCGACATGGCCGACGACAACACGCGGGCTGGTCTGGAAATGTGCGGCATCATCTGCGGCA
TGCCGGTCAACAACGCCCTGTTCGTGCGCAGCTTGATCATTCCCGATCAGAGGTGCACGTCGGACACGTGCGAAA
CAGAAAACGAAGGTGCGATATTCGACTATTGCTCCAGCGAGGATTTGATTGTTCTGGGATGGATCCACACGCACC
CGACGCAGACGTGCTTCATGAGCTCTCGCGACTTGCACACGCACGCCGGCTACCAGGTCATGATGCCAGAGAGCA
TCGCCATCGTCTGCGCTCCCAGATTCAAGCCATCGTGCGTGTTGATCCCGTGTTTGCCGCATGGCGCGGCGATGC
CGTCCCGTGACGCCGTCCCGTACTGACCGCGCACAGATACGGAATCTTTCGCCTCACCCATCCTCCCGGCCTCGA
ACACATCCTGGACTGCAAACACCAGGATACCTTCCATCAGCATTCGATCGACAACATATATCGCGACTCGGAGCA
CCCGGGTGGCCACGTCTACGAAAGCGATACCTTGCCCTTTTACGTCAGGGACCTGCGAACGAAGCCGACATTTTA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail