Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8593
Gene name
LocationContig_570:7930..9731
Strand-
Gene length (bp)1801
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease 3.7E-13 372 477
PF08969 USP8_dimer USP8 dimerisation domain 3.0E-08 19 119

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 358 550 6.0E-55
sp|Q8VYB5|AMSH1_ARATH AMSH-like ubiquitin thioesterase 1 OS=Arabidopsis thaliana GN=AMSH1 PE=2 SV=1 34 548 1.0E-45
sp|Q5PNU3|AMSH3_ARATH AMSH-like ubiquitin thioesterase 3 OS=Arabidopsis thaliana GN=AMSH3 PE=1 SV=2 25 548 3.0E-43
sp|Q6TH47|STBPA_DANRE STAM-binding protein-like A OS=Danio rerio GN=stambpa PE=2 SV=3 319 518 1.0E-41
sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens GN=STAMBP PE=1 SV=1 352 521 2.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 358 550 6.0E-55
sp|Q8VYB5|AMSH1_ARATH AMSH-like ubiquitin thioesterase 1 OS=Arabidopsis thaliana GN=AMSH1 PE=2 SV=1 34 548 1.0E-45
sp|Q5PNU3|AMSH3_ARATH AMSH-like ubiquitin thioesterase 3 OS=Arabidopsis thaliana GN=AMSH3 PE=1 SV=2 25 548 3.0E-43
sp|Q6TH47|STBPA_DANRE STAM-binding protein-like A OS=Danio rerio GN=stambpa PE=2 SV=3 319 518 1.0E-41
sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens GN=STAMBP PE=1 SV=1 352 521 2.0E-41
sp|Q54Q40|D1039_DICDI Probable ubiquitin thioesterase DG1039 OS=Dictyostelium discoideum GN=DG1039 PE=3 SV=1 310 518 2.0E-41
sp|Q63ZM7|STABP_XENLA STAM-binding protein-like OS=Xenopus laevis GN=stambp PE=2 SV=1 323 518 1.0E-40
sp|Q8R424|STABP_RAT STAM-binding protein OS=Rattus norvegicus GN=Stambp PE=2 SV=1 298 521 2.0E-39
sp|Q9CQ26|STABP_MOUSE STAM-binding protein OS=Mus musculus GN=Stambp PE=1 SV=1 298 521 2.0E-39
sp|Q96FJ0|STALP_HUMAN AMSH-like protease OS=Homo sapiens GN=STAMBPL1 PE=1 SV=2 369 519 1.0E-37
sp|Q5R558|STALP_PONAB AMSH-like protease OS=Pongo abelii GN=STAMBPL1 PE=2 SV=1 369 519 6.0E-37
sp|Q76N33|STALP_MOUSE AMSH-like protease OS=Mus musculus GN=Stambpl1 PE=1 SV=1 348 521 3.0E-36
sp|Q6NKP9|AMSH2_ARATH AMSH-like ubiquitin thioesterase 2 OS=Arabidopsis thaliana GN=AMSH2 PE=2 SV=1 371 548 2.0E-35
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 15 145 1.0E-09
sp|Q6FKA3|RFU1_CANGA Regulator of free ubiquitin chains 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RFU1 PE=3 SV=1 21 131 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8593
MEPRSPRPPPRPSRPPTISALVAQAENFTFNANIPFKHWVRAAETLHQEASFAMSDGDYGRAYWLLYRHSKLVLE
HMPSHPRYRDRDSRLMFRSLSRRIDSVLDELERLKPGLEDEYEKWEQANARPARQPSTPSAPTSPASYADFAARD
PSLYGPARVLDASEHRELAVDLARKELARRDRAKRAARAQLAPPASPTSGHAAHRDGRSLDAHEDDFRRQMEAAR
RALSLSQLSGRTEGRAAGPGGAHQPIPAPFNYPSIARSRPVDDDAAHRQRRPPAAPAPDRPPKESLAPSTSQDPS
VCTPNADGLLPAVPRKLPLEDQAGPPPPASSAPANQPPLPPKGLPVDGPPLPRRDRLTFKPGAYLENGDPIRSVF
IPSQLRSAFLDMADDNTRAGLEMCGIICGMPVNNALFVRSLIIPDQRCTSDTCETENEGAIFDYCSSEDLIVLGW
IHTHPTQTCFMSSRDLHTHAGYQVMMPESIAIVCAPRFKPSYGIFRLTHPPGLEHILDCKHQDTFHQHSIDNIYR
DSEHPGGHVYESDTLPFYVRDLRTKPTF*
Coding >Hirsu2|8593
ATGGAGCCGCGCTCGCCTCGTCCGCCGCCGCGGCCCTCGCGCCCGCCGACCATCAGCGCGCTGGTCGCCCAGGCC
GAGAACTTCACCTTCAACGCAAACATCCCGTTCAAGCACTGGGTCAGAGCGGCCGAGACGCTGCATCAAGAGGCC
TCCTTCGCCATGTCCGACGGCGACTACGGCCGTGCCTACTGGCTGCTCTATCGCCACTCGAAACTCGTCCTCGAG
CACATGCCCTCGCACCCGCGCTACAGGGACCGTGACAGCCGCCTCATGTTTCGCTCCTTGTCCCGACGCATCGAC
AGCGTCCTCGACGAACTAGAGCGCCTCAAACCCGGCCTGGAAGACGAATATGAGAAATGGGAGCAGGCCAACGCG
CGCCCCGCTCGACAGCCGAGCACGCCAAGCGCACCGACGTCGCCAGCCAGCTACGCCGACTTTGCCGCACGCGAC
CCCAGCCTGTATGGCCCTGCCCGCGTGCTCGACGCCTCGGAGCACCGCGAGCTGGCCGTTGACTTGGCCCGGAAG
GAGCTGGCGCGGAGAGATAGGGCCAAACGGGCGGCCAGGGCACAGCTTGCGCCACCTGCTTCGCCGACGAGCGGC
CACGCCGCCCACCGAGACGGTAGATCCCTAGACGCCCATGAAGATGACTTTCGTCGGCAGATGGAAGCCGCCAGG
CGCGCTTTGAGCCTCAGTCAGCTGTCGGGAAGAACAGAAGGGAGGGCGGCCGGGCCCGGTGGTGCTCACCAGCCG
ATCCCGGCTCCGTTCAATTATCCCTCGATAGCCAGGTCGAGGCCCGTCGACGACGATGCCGCCCATCGCCAGCGG
CGCCCACCCGCAGCGCCGGCGCCTGACCGGCCGCCCAAGGAGAGCCTGGCGCCGTCAACGAGCCAGGACCCGTCG
GTTTGTACCCCCAATGCCGATGGCCTGCTGCCAGCCGTTCCACGCAAACTGCCGCTGGAGGACCAAGCCGGACCT
CCTCCGCCGGCCTCCTCCGCTCCTGCTAATCAACCCCCTTTACCGCCAAAGGGACTGCCCGTGGATGGACCGCCG
CTCCCTAGGAGAGATCGGCTCACGTTTAAGCCCGGGGCGTACCTCGAGAACGGCGACCCGATCCGATCCGTCTTC
ATCCCCAGCCAGCTACGGTCGGCCTTCCTCGACATGGCCGACGACAACACGCGGGCTGGTCTGGAAATGTGCGGC
ATCATCTGCGGCATGCCGGTCAACAACGCCCTGTTCGTGCGCAGCTTGATCATTCCCGATCAGAGGTGCACGTCG
GACACGTGCGAAACAGAAAACGAAGGTGCGATATTCGACTATTGCTCCAGCGAGGATTTGATTGTTCTGGGATGG
ATCCACACGCACCCGACGCAGACGTGCTTCATGAGCTCTCGCGACTTGCACACGCACGCCGGCTACCAGGTCATG
ATGCCAGAGAGCATCGCCATCGTCTGCGCTCCCAGATTCAAGCCATCATACGGAATCTTTCGCCTCACCCATCCT
CCCGGCCTCGAACACATCCTGGACTGCAAACACCAGGATACCTTCCATCAGCATTCGATCGACAACATATATCGC
GACTCGGAGCACCCGGGTGGCCACGTCTACGAAAGCGATACCTTGCCCTTTTACGTCAGGGACCTGCGAACGAAG
CCGACATTTTAG
Transcript >Hirsu2|8593
ATGGAGCCGCGCTCGCCTCGTCCGCCGCCGCGGCCCTCGCGCCCGCCGACCATCAGCGCGCTGGTCGCCCAGGCC
GAGAACTTCACCTTCAACGCAAACATCCCGTTCAAGCACTGGGTCAGAGCGGCCGAGACGCTGCATCAAGAGGCC
TCCTTCGCCATGTCCGACGGCGACTACGGCCGTGCCTACTGGCTGCTCTATCGCCACTCGAAACTCGTCCTCGAG
CACATGCCCTCGCACCCGCGCTACAGGGACCGTGACAGCCGCCTCATGTTTCGCTCCTTGTCCCGACGCATCGAC
AGCGTCCTCGACGAACTAGAGCGCCTCAAACCCGGCCTGGAAGACGAATATGAGAAATGGGAGCAGGCCAACGCG
CGCCCCGCTCGACAGCCGAGCACGCCAAGCGCACCGACGTCGCCAGCCAGCTACGCCGACTTTGCCGCACGCGAC
CCCAGCCTGTATGGCCCTGCCCGCGTGCTCGACGCCTCGGAGCACCGCGAGCTGGCCGTTGACTTGGCCCGGAAG
GAGCTGGCGCGGAGAGATAGGGCCAAACGGGCGGCCAGGGCACAGCTTGCGCCACCTGCTTCGCCGACGAGCGGC
CACGCCGCCCACCGAGACGGTAGATCCCTAGACGCCCATGAAGATGACTTTCGTCGGCAGATGGAAGCCGCCAGG
CGCGCTTTGAGCCTCAGTCAGCTGTCGGGAAGAACAGAAGGGAGGGCGGCCGGGCCCGGTGGTGCTCACCAGCCG
ATCCCGGCTCCGTTCAATTATCCCTCGATAGCCAGGTCGAGGCCCGTCGACGACGATGCCGCCCATCGCCAGCGG
CGCCCACCCGCAGCGCCGGCGCCTGACCGGCCGCCCAAGGAGAGCCTGGCGCCGTCAACGAGCCAGGACCCGTCG
GTTTGTACCCCCAATGCCGATGGCCTGCTGCCAGCCGTTCCACGCAAACTGCCGCTGGAGGACCAAGCCGGACCT
CCTCCGCCGGCCTCCTCCGCTCCTGCTAATCAACCCCCTTTACCGCCAAAGGGACTGCCCGTGGATGGACCGCCG
CTCCCTAGGAGAGATCGGCTCACGTTTAAGCCCGGGGCGTACCTCGAGAACGGCGACCCGATCCGATCCGTCTTC
ATCCCCAGCCAGCTACGGTCGGCCTTCCTCGACATGGCCGACGACAACACGCGGGCTGGTCTGGAAATGTGCGGC
ATCATCTGCGGCATGCCGGTCAACAACGCCCTGTTCGTGCGCAGCTTGATCATTCCCGATCAGAGGTGCACGTCG
GACACGTGCGAAACAGAAAACGAAGGTGCGATATTCGACTATTGCTCCAGCGAGGATTTGATTGTTCTGGGATGG
ATCCACACGCACCCGACGCAGACGTGCTTCATGAGCTCTCGCGACTTGCACACGCACGCCGGCTACCAGGTCATG
ATGCCAGAGAGCATCGCCATCGTCTGCGCTCCCAGATTCAAGCCATCATACGGAATCTTTCGCCTCACCCATCCT
CCCGGCCTCGAACACATCCTGGACTGCAAACACCAGGATACCTTCCATCAGCATTCGATCGACAACATATATCGC
GACTCGGAGCACCCGGGTGGCCACGTCTACGAAAGCGATACCTTGCCCTTTTACGTCAGGGACCTGCGAACGAAG
CCGACATTTTAG
Gene >Hirsu2|8593
ATGGAGCCGCGCTCGCCTCGTCCGCCGCCGCGGCCCTCGCGCCCGCCGACCATCAGCGCGCTGGTCGCCCAGGCC
GAGAACTTCACCTTCAACGCAAACATCCCGTTCAAGCACTGGGTCAGAGCGGCCGAGACGCTGCATCAAGAGGTC
CAGCACCGCCCCTCCCCGTCCTCGTCTCGGCATCGAGCCGCAGCTGACAGCCGCCTCAGGCCTCCTTCGCCATGT
CCGACGGCGACTACGGCCGTGCCTACTGGCTGCTCTATCGCCACTCGAAACTCGTCCTCGAGCACATGCCCTCGC
ACCCGCGCTACAGGGACCGTGACAGCCGCCTCATGTTTCGCTCCTTGTCCCGACGCATCGACAGCGTCCTCGACG
AACTAGAGCGCCTCAAACCCGGCCTGGAAGACGAATATGAGAAATGGGAGCAGGCCAACGCGCGCCCCGCTCGAC
AGCCGAGCACGCCAAGCGCACCGACGTCGCCAGCCAGCTACGCCGACTTTGCCGCACGCGACCCCAGCCTGTATG
GCCCTGCCCGCGTGCTCGACGCCTCGGAGCACCGCGAGCTGGCCGTTGACTTGGCCCGGAAGGAGCTGGCGCGGA
GAGATAGGGCCAAACGGGCGGCCAGGGCACAGCTTGCGCCACCTGCTTCGCCGACGAGCGGCCACGCCGCCCACC
GAGACGGTAGATCCCTAGACGCCCATGAAGATGACTTTCGTCGGCAGATGGAAGCCGCCAGGCGCGCTTTGAGCC
TCAGTCAGCTGTCGGGAAGAACAGAAGGGAGGGCGGCCGGGCCCGGTGGTGCTCACCAGCCGATCCCGGCTCCGT
TCAATTATCCCTCGATAGCCAGGTCGAGGCCCGTCGACGACGATGCCGCCCATCGCCAGCGGCGCCCACCCGCAG
CGCCGGCGCCTGACCGGCCGCCCAAGGAGAGCCTGGCGCCGTCAACGAGCCAGGACCCGTCGGTTTGTACCCCCA
ATGCCGATGGCCTGCTGCCAGCCGTTCCACGCAAACTGCCGCTGGAGGACCAAGCCGGACCTCCTCCGCCGGCCT
CCTCCGCTCCTGCTAATCAACCCCCTTTACCGCCAAAGGGACTGCCCGTGGATGGACCGCCGCTCCCTAGGAGAG
ATCGGCTCACGTTTAAGCCCGGGGCGTACCTCGAGAACGGCGACCCGATCCGATCCGTCTTCATCCCCAGCCAGC
TACGGTCGGCCTTCCTCGACATGGCCGACGACAACACGCGGGCTGGTCTGGAAATGTGCGGCATCATCTGCGGCA
TGCCGGTCAACAACGCCCTGTTCGTGCGCAGCTTGATCATTCCCGATCAGAGGTGCACGTCGGACACGTGCGAAA
CAGAAAACGAAGGTGCGATATTCGACTATTGCTCCAGCGAGGATTTGATTGTTCTGGGATGGATCCACACGCACC
CGACGCAGACGTGCTTCATGAGCTCTCGCGACTTGCACACGCACGCCGGCTACCAGGTCATGATGCCAGAGAGCA
TCGCCATCGTCTGCGCTCCCAGATTCAAGCCATCGTGCGTGTTGATCCCGTGTTTGCCGCATGGCGCGGCGATGC
CGTCCCGTGACGCCGTCCCGTACTGACCGCGCACAGATACGGAATCTTTCGCCTCACCCATCCTCCCGGCCTCGA
ACACATCCTGGACTGCAAACACCAGGATACCTTCCATCAGCATTCGATCGACAACATATATCGCGACTCGGAGCA
CCCGGGTGGCCACGTCTACGAAAGCGATACCTTGCCCTTTTACGTCAGGGACCTGCGAACGAAGCCGACATTTTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail