Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8590
Gene name
LocationContig_570:124..3145
Strand-
Gene length (bp)3021
Transcript length (bp)2556
Coding sequence length (bp)2556
Protein length (aa) 852

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03098 An_peroxidase Animal haem peroxidase 2.0E-10 170 250
PF03098 An_peroxidase Animal haem peroxidase 2.8E-25 300 633

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y6R2|PPOA_ASPFC Psi-producing oxygenase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=ppoA PE=3 SV=1 43 841 0.0E+00
sp|Q4WPX2|PPOA_ASPFU Psi-producing oxygenase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppoA PE=2 SV=1 43 841 0.0E+00
sp|G5EB19|PPOA_EMENI Psi-producing oxygenase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppoA PE=3 SV=1 65 841 0.0E+00
sp|Q6RET3|PPOA_EMEND Psi-producing oxygenase A OS=Emericella nidulans GN=ppoA PE=1 SV=1 65 841 0.0E+00
sp|Q9UUS2|LIDS_GAEGR Linoleate diol synthase OS=Gaeumannomyces graminis var. graminis PE=1 SV=3 66 841 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y6R2|PPOA_ASPFC Psi-producing oxygenase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=ppoA PE=3 SV=1 43 841 0.0E+00
sp|Q4WPX2|PPOA_ASPFU Psi-producing oxygenase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppoA PE=2 SV=1 43 841 0.0E+00
sp|G5EB19|PPOA_EMENI Psi-producing oxygenase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppoA PE=3 SV=1 65 841 0.0E+00
sp|Q6RET3|PPOA_EMEND Psi-producing oxygenase A OS=Emericella nidulans GN=ppoA PE=1 SV=1 65 841 0.0E+00
sp|Q9UUS2|LIDS_GAEGR Linoleate diol synthase OS=Gaeumannomyces graminis var. graminis PE=1 SV=3 66 841 0.0E+00
sp|Q4WY82|PPOC_ASPFU Linoleate 10R-lipoxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppoC PE=1 SV=2 27 841 0.0E+00
sp|Q05769|PGH2_MOUSE Prostaglandin G/H synthase 2 OS=Mus musculus GN=Ptgs2 PE=1 SV=1 206 583 7.0E-23
sp|O62725|PGH2_NEOVI Prostaglandin G/H synthase 2 OS=Neovison vison GN=PTGS2 PE=2 SV=1 206 583 9.0E-23
sp|P35355|PGH2_RAT Prostaglandin G/H synthase 2 OS=Rattus norvegicus GN=Ptgs2 PE=1 SV=1 206 583 3.0E-22
sp|O02768|PGH2_RABIT Prostaglandin G/H synthase 2 OS=Oryctolagus cuniculus GN=PTGS2 PE=2 SV=1 206 583 4.0E-22
sp|O62698|PGH2_BOVIN Prostaglandin G/H synthase 2 OS=Bos taurus GN=PTGS2 PE=2 SV=2 206 583 2.0E-21
sp|P79208|PGH2_SHEEP Prostaglandin G/H synthase 2 OS=Ovis aries GN=PTGS2 PE=1 SV=1 206 581 4.0E-21
sp|P35354|PGH2_HUMAN Prostaglandin G/H synthase 2 OS=Homo sapiens GN=PTGS2 PE=1 SV=2 206 583 4.0E-21
sp|P27607|PGH2_CHICK Prostaglandin G/H synthase 2 OS=Gallus gallus GN=PTGS2 PE=2 SV=1 206 583 1.0E-20
sp|O19183|PGH2_HORSE Prostaglandin G/H synthase 2 OS=Equus caballus GN=PTGS2 PE=2 SV=1 187 583 2.0E-20
sp|P70682|PGH2_CAVPO Prostaglandin G/H synthase 2 OS=Cavia porcellus GN=PTGS2 PE=2 SV=1 206 583 3.0E-20
sp|O62664|PGH1_BOVIN Prostaglandin G/H synthase 1 OS=Bos taurus GN=PTGS1 PE=2 SV=2 199 582 5.0E-19
sp|P05979|PGH1_SHEEP Prostaglandin G/H synthase 1 OS=Ovis aries GN=PTGS1 PE=1 SV=3 206 582 1.0E-18
sp|O97554|PGH1_RABIT Prostaglandin G/H synthase 1 OS=Oryctolagus cuniculus GN=PTGS1 PE=2 SV=1 199 583 3.0E-18
sp|Q8HZR1|PGH1_CANLF Prostaglandin G/H synthase 1 OS=Canis lupus familiaris GN=PTGS1 PE=1 SV=2 206 582 1.0E-17
sp|P22437|PGH1_MOUSE Prostaglandin G/H synthase 1 OS=Mus musculus GN=Ptgs1 PE=1 SV=1 199 583 7.0E-17
sp|P23219|PGH1_HUMAN Prostaglandin G/H synthase 1 OS=Homo sapiens GN=PTGS1 PE=1 SV=2 206 582 2.0E-16
sp|Q63921|PGH1_RAT Prostaglandin G/H synthase 1 OS=Rattus norvegicus GN=Ptgs1 PE=2 SV=2 199 583 2.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8590
MSPAAASSKNGHGAYDDGENGAQAGAHTNGSQVNGAGSAKRGKQQKSSAKPPKAQTWSLSHYRQASRRPLPTEMG
DGSYRTVTKRPSLLQDARTIGWADVKTVKEIVMAKLRGQTQADDKTMLMERTIKMVASLPDHSSRQETLTNFFID
ELWNSLDHPPLLYMGNEFRYRQPDGSNNNPLMPKLGAAGTPYARTVKPGKANLGALPDPETVYESVMARSEFKKN
PNNVSSILWYWATIIIHDLFSTNMRDGNQNDSSSYLDLSPLYGSSQEAVDSVRTFKDGMLKPDTFADRRLLGNPP
GVCILLVMFNRFHNYIAGKLAEINENDRFRRPGPQLGSEEAAAAWKKYDEELFQTARLVTSGLYINITLVDYVRN
IINLNRVDSAWTLDPRQEMGVSAGTSKGADSGVGNVVSAEFNLCYRWHSCISAMDDEWIQDFYKQLLGDDYGEMN
LETLMAAVKKFEMGVARDPGERTFGGFRRGADGRFDDDELVDCLATAIEQAGGAFGARNVPRIMKPVEMLGILRG
RRWNLAGLNEFRKHFGLRAYATFEDINSDPEVAGALRHLYQHPDHVELYPGIVAEEAKTPMTPGVGIAPTYTISR
VVLSDAVSLVRGDRHYTTDYHPGYLTQWAYNEVDYDFGVNHGCVFYKLFNRAFPHHFRRDSVYAHYPMVTPAENR
KILTDLRRVQLFSFDRPRFTAPPVAVGSVAGIKHVLGHDDRYPVHWHAGLDRLMGRDRAAPPLAAERRHLDDLIY
RDSWRASIKAFFAAAADRLLADKSYRLGGRRQCDVVRDVGNLAHTHFAARLFNLPLKSADNPRGVFSERELYDTL
ATLFTSIFFDLDPVKSTTAWPPTAST*
Coding >Hirsu2|8590
ATGTCCCCAGCAGCGGCCTCGTCCAAGAACGGCCATGGGGCCTACGACGACGGCGAGAACGGCGCCCAGGCCGGC
GCCCACACCAACGGCTCCCAGGTCAACGGGGCCGGCTCGGCGAAACGCGGCAAGCAGCAGAAGTCGTCGGCCAAG
CCGCCCAAGGCCCAGACCTGGTCGCTGTCACACTACCGCCAGGCCTCGCGCCGGCCGCTGCCGACCGAGATGGGC
GACGGCTCGTACCGGACGGTGACGAAGCGGCCGAGCCTGCTGCAGGACGCCCGAACCATCGGATGGGCAGACGTC
AAGACGGTCAAGGAGATCGTCATGGCCAAGCTCAGGGGCCAAACGCAGGCGGACGACAAGACGATGCTCATGGAG
CGGACGATCAAGATGGTGGCCTCCCTGCCGGACCACTCGTCCCGGCAGGAGACGCTGACCAACTTCTTCATCGAC
GAGCTGTGGAACTCGCTCGACCACCCGCCGCTGCTGTACATGGGCAATGAGTTTCGCTACCGCCAGCCCGACGGC
TCCAACAACAACCCCCTGATGCCCAAGCTGGGCGCGGCCGGCACGCCGTACGCGCGGACGGTTAAGCCGGGCAAG
GCGAACCTCGGGGCGCTGCCGGACCCGGAGACGGTGTACGAGTCGGTCATGGCGCGGTCCGAGTTCAAGAAGAAC
CCGAACAACGTGTCGAGCATCTTGTGGTACTGGGCCACCATCATCATCCACGATCTGTTCAGCACCAACATGCGC
GACGGCAACCAAAACGACTCGTCGTCGTACCTCGATCTGTCCCCCCTGTACGGCAGCTCGCAGGAGGCGGTGGAC
TCGGTGCGGACGTTCAAGGACGGCATGCTCAAGCCGGACACGTTCGCGGACCGGCGGCTGCTGGGCAACCCGCCG
GGGGTGTGCATCCTGCTCGTCATGTTCAACCGGTTCCACAACTACATCGCGGGCAAGCTGGCCGAGATCAACGAG
AACGACCGGTTCCGGCGGCCCGGGCCGCAGCTGGGGTCGGAGGAGGCGGCGGCGGCGTGGAAGAAGTACGACGAG
GAGCTGTTCCAGACGGCGCGGCTGGTGACGTCGGGCCTGTACATCAACATCACGCTCGTCGACTACGTGCGCAAC
ATCATCAACCTCAACCGCGTCGACTCGGCCTGGACGCTGGACCCGCGGCAGGAGATGGGCGTGTCGGCCGGGACG
TCCAAGGGGGCCGACAGCGGCGTCGGCAACGTCGTCTCGGCCGAGTTCAATCTCTGCTACCGCTGGCACTCGTGC
ATCTCCGCCATGGACGACGAGTGGATCCAGGACTTCTACAAGCAGCTGCTGGGCGACGACTACGGCGAGATGAAC
CTCGAGACGCTGATGGCGGCCGTCAAGAAGTTCGAGATGGGCGTGGCGCGCGACCCGGGCGAGCGCACCTTCGGC
GGCTTCCGGCGCGGGGCCGACGGCCGGTTCGACGACGACGAGCTGGTCGACTGCCTGGCGACGGCCATCGAGCAG
GCGGGCGGGGCGTTCGGGGCGCGCAACGTGCCGCGCATCATGAAGCCGGTCGAGATGCTCGGCATCCTGCGCGGC
CGGCGCTGGAACCTGGCCGGGCTCAACGAGTTCCGCAAGCACTTCGGCCTGCGCGCCTACGCCACCTTCGAGGAC
ATCAACTCGGACCCCGAGGTGGCGGGCGCGCTGCGGCACCTGTACCAGCACCCGGACCACGTCGAGCTGTACCCG
GGCATCGTGGCCGAGGAGGCCAAGACGCCCATGACGCCGGGCGTCGGCATCGCGCCCACCTACACCATCTCGCGC
GTCGTTCTGAGCGACGCCGTCTCGCTCGTCCGCGGCGACCGCCACTACACCACCGACTACCACCCGGGCTACCTG
ACCCAGTGGGCCTACAACGAGGTCGACTACGACTTCGGCGTCAACCACGGCTGCGTCTTCTACAAGCTCTTCAAC
CGCGCCTTCCCGCACCACTTCCGTCGCGACTCCGTCTACGCCCACTACCCGATGGTGACGCCGGCCGAGAACCGC
AAGATCCTGACGGACCTGCGCCGCGTCCAGCTCTTCAGCTTCGACCGGCCCCGCTTCACGGCCCCACCCGTCGCC
GTCGGCTCCGTCGCCGGCATCAAGCACGTCCTCGGCCACGACGACCGCTACCCCGTCCACTGGCACGCCGGCCTC
GACCGCCTCATGGGCCGCGACCGCGCCGCGCCCCCGCTCGCCGCCGAGCGCCGCCACCTCGACGACCTCATCTAC
CGCGACAGCTGGCGCGCCTCCATCAAGGCCTTCTTCGCCGCCGCCGCCGACCGCCTGCTGGCCGACAAGTCGTAC
CGCCTCGGCGGCCGCCGCCAGTGCGACGTCGTCCGCGACGTCGGCAACCTGGCCCACACCCACTTCGCCGCCCGC
CTCTTCAACCTGCCGCTCAAGTCGGCCGACAACCCGCGCGGCGTCTTCTCCGAGCGCGAGCTGTACGACACCCTC
GCCACCCTCTTCACCTCCATCTTCTTCGACCTCGACCCGGTCAAGTCGACGACAGCCTGGCCGCCTACGGCGTCA
ACCTGA
Transcript >Hirsu2|8590
ATGTCCCCAGCAGCGGCCTCGTCCAAGAACGGCCATGGGGCCTACGACGACGGCGAGAACGGCGCCCAGGCCGGC
GCCCACACCAACGGCTCCCAGGTCAACGGGGCCGGCTCGGCGAAACGCGGCAAGCAGCAGAAGTCGTCGGCCAAG
CCGCCCAAGGCCCAGACCTGGTCGCTGTCACACTACCGCCAGGCCTCGCGCCGGCCGCTGCCGACCGAGATGGGC
GACGGCTCGTACCGGACGGTGACGAAGCGGCCGAGCCTGCTGCAGGACGCCCGAACCATCGGATGGGCAGACGTC
AAGACGGTCAAGGAGATCGTCATGGCCAAGCTCAGGGGCCAAACGCAGGCGGACGACAAGACGATGCTCATGGAG
CGGACGATCAAGATGGTGGCCTCCCTGCCGGACCACTCGTCCCGGCAGGAGACGCTGACCAACTTCTTCATCGAC
GAGCTGTGGAACTCGCTCGACCACCCGCCGCTGCTGTACATGGGCAATGAGTTTCGCTACCGCCAGCCCGACGGC
TCCAACAACAACCCCCTGATGCCCAAGCTGGGCGCGGCCGGCACGCCGTACGCGCGGACGGTTAAGCCGGGCAAG
GCGAACCTCGGGGCGCTGCCGGACCCGGAGACGGTGTACGAGTCGGTCATGGCGCGGTCCGAGTTCAAGAAGAAC
CCGAACAACGTGTCGAGCATCTTGTGGTACTGGGCCACCATCATCATCCACGATCTGTTCAGCACCAACATGCGC
GACGGCAACCAAAACGACTCGTCGTCGTACCTCGATCTGTCCCCCCTGTACGGCAGCTCGCAGGAGGCGGTGGAC
TCGGTGCGGACGTTCAAGGACGGCATGCTCAAGCCGGACACGTTCGCGGACCGGCGGCTGCTGGGCAACCCGCCG
GGGGTGTGCATCCTGCTCGTCATGTTCAACCGGTTCCACAACTACATCGCGGGCAAGCTGGCCGAGATCAACGAG
AACGACCGGTTCCGGCGGCCCGGGCCGCAGCTGGGGTCGGAGGAGGCGGCGGCGGCGTGGAAGAAGTACGACGAG
GAGCTGTTCCAGACGGCGCGGCTGGTGACGTCGGGCCTGTACATCAACATCACGCTCGTCGACTACGTGCGCAAC
ATCATCAACCTCAACCGCGTCGACTCGGCCTGGACGCTGGACCCGCGGCAGGAGATGGGCGTGTCGGCCGGGACG
TCCAAGGGGGCCGACAGCGGCGTCGGCAACGTCGTCTCGGCCGAGTTCAATCTCTGCTACCGCTGGCACTCGTGC
ATCTCCGCCATGGACGACGAGTGGATCCAGGACTTCTACAAGCAGCTGCTGGGCGACGACTACGGCGAGATGAAC
CTCGAGACGCTGATGGCGGCCGTCAAGAAGTTCGAGATGGGCGTGGCGCGCGACCCGGGCGAGCGCACCTTCGGC
GGCTTCCGGCGCGGGGCCGACGGCCGGTTCGACGACGACGAGCTGGTCGACTGCCTGGCGACGGCCATCGAGCAG
GCGGGCGGGGCGTTCGGGGCGCGCAACGTGCCGCGCATCATGAAGCCGGTCGAGATGCTCGGCATCCTGCGCGGC
CGGCGCTGGAACCTGGCCGGGCTCAACGAGTTCCGCAAGCACTTCGGCCTGCGCGCCTACGCCACCTTCGAGGAC
ATCAACTCGGACCCCGAGGTGGCGGGCGCGCTGCGGCACCTGTACCAGCACCCGGACCACGTCGAGCTGTACCCG
GGCATCGTGGCCGAGGAGGCCAAGACGCCCATGACGCCGGGCGTCGGCATCGCGCCCACCTACACCATCTCGCGC
GTCGTTCTGAGCGACGCCGTCTCGCTCGTCCGCGGCGACCGCCACTACACCACCGACTACCACCCGGGCTACCTG
ACCCAGTGGGCCTACAACGAGGTCGACTACGACTTCGGCGTCAACCACGGCTGCGTCTTCTACAAGCTCTTCAAC
CGCGCCTTCCCGCACCACTTCCGTCGCGACTCCGTCTACGCCCACTACCCGATGGTGACGCCGGCCGAGAACCGC
AAGATCCTGACGGACCTGCGCCGCGTCCAGCTCTTCAGCTTCGACCGGCCCCGCTTCACGGCCCCACCCGTCGCC
GTCGGCTCCGTCGCCGGCATCAAGCACGTCCTCGGCCACGACGACCGCTACCCCGTCCACTGGCACGCCGGCCTC
GACCGCCTCATGGGCCGCGACCGCGCCGCGCCCCCGCTCGCCGCCGAGCGCCGCCACCTCGACGACCTCATCTAC
CGCGACAGCTGGCGCGCCTCCATCAAGGCCTTCTTCGCCGCCGCCGCCGACCGCCTGCTGGCCGACAAGTCGTAC
CGCCTCGGCGGCCGCCGCCAGTGCGACGTCGTCCGCGACGTCGGCAACCTGGCCCACACCCACTTCGCCGCCCGC
CTCTTCAACCTGCCGCTCAAGTCGGCCGACAACCCGCGCGGCGTCTTCTCCGAGCGCGAGCTGTACGACACCCTC
GCCACCCTCTTCACCTCCATCTTCTTCGACCTCGACCCGGTCAAGTCGACGACAGCCTGGCCGCCTACGGCGTCA
ACCTGA
Gene >Hirsu2|8590
ATGTCCCCAGCAGCGGCCTCGTCCAAGAACGGCCATGGGGCCTACGACGACGGCGAGAACGGCGCCCAGGCCGGC
GCCCACACCAACGGCTCCCAGGTCAACGGGGCCGGCTCGGCGAAACGCGGCAAGCAGCAGAAGTCGTCGGCCAAG
CCGCCCAAGGCCCAGACCTGGTCGCTGTCACACTACCGCCAGGCCTCGCGCCGGCCGCTGCCGACCGAGATGGGC
GACGGCTCGTACCGGACGGTGACGAAGCGGCCGAGCCTGCTGCAGGACGCCCGAACCATCGGATGGGCAGGTTAG
TTGAGTCCCCAACGACAACGCCGACGACGACGACGACAGCCCGCAGCGGGGTTGGGGAAACGGAAGGGACGCGAA
GACGTTGATGGTGTTGGGATGCTTATATGCTGACGATCGGGGCGGGGGACAGACGTCAAGACGGTCAAGGAGATC
GTCATGGCCAAGCTCAGGGGCCAAACGCAGGCGGACGACAAGACGATGCTCATGGAGCGGACGATCAAGATGGTG
GCCTCCCTGCCGGACCACTCGTCCCGGCAGGAGACGCTGACCAACTTCTTCATCGACGAGCTGTGGAACTCGCTC
GACCACCCGCCGCTGCTGTACATGGGCAATGAGTTTCGCTACCGCCAGCCCGACGGCTCCAACAACGTAAGCAAA
GAGACGATTCGGGGAGAGGAGAGAGAGAGAGAGAGACAGAGAGAGAGAGGAAGAAAGAGAGAGAGAAAGAAGGAG
AGAGAGAGAGAGAGAGAGAGAGAGAGAGAGACGAGATCTGAACTGACGTGATGAGACCTCTTCAGAACCCCCTGA
TGCCCAAGCTGGGCGCGGCCGGCACGCCGTACGCGCGGACGGTTAAGCCGGGCAAGGCGAACCTCGGGGCGCTGC
CGGACCCGGAGACGGTGTACGAGTCGGTCATGGCGCGGTCCGAGTTCAAGAAGAACCCGAACAACGTGTCGAGCA
TCTTGTGGTACTGGGCCACCATCATCATCCACGGTAATGCCCGTCCCCCCCCCCCTCGGGATAAGTCGTGCCCGT
CCTGACGCCGGTGACGACGGGCAGATCTGTTCAGCACCAACATGCGCGACGGCAACCAAAACGACTCGTCGTCGT
ACCTCGATCTGTCCCCCCTGTACGGCAGCTCGCAGGAGGCGGTGGACTCGGTGCGGACGTTCAAGGACGGCATGC
TCAAGCCGGACACGTTCGCGGACCGGCGGCTGCTGGGCAACCCGCCGGGGGTGTGCATCCTGCTCGTCATGTTCA
ACCGGTTCCACAACTACATCGCGGGCAAGCTGGCCGAGATCAACGAGAACGACCGGTTCCGGCGGCCCGGGCCGC
AGCTGGGGTCGGAGGAGGCGGCGGCGGCGTGGAAGAAGTACGACGAGGAGCTGTTCCAGACGGCGCGGCTGGTGA
CGTCGGGCCTGTACATCAACATCACGCTCGTCGACTACGTGCGCAACATCATCAACCTCAACCGCGTCGACTCGG
CCTGGACGCTGGACCCGCGGCAGGAGATGGGCGTGTCGGCCGGGACGTCCAAGGGGGCCGACAGCGGCGTCGGCA
ACGTCGTCTCGGCCGAGTTCAATCTCTGCTACCGCTGGCACTCGTGCATCTCCGCCATGGACGACGAGTGGATCC
AGGACTTCTACAAGCAGCTGCTGGGCGACGACTACGGCGAGATGAACCTCGAGACGCTGATGGCGGCCGTCAAGA
AGTTCGAGATGGGCGTGGCGCGCGACCCGGGCGAGCGCACCTTCGGCGGCTTCCGGCGCGGGGCCGACGGCCGGT
TCGACGACGACGAGCTGGTCGACTGCCTGGCGACGGCCATCGAGCAGGCGGGCGGGGCGTTCGGGGCGCGCAACG
TGCCGCGCATCATGAAGCCGGTCGAGATGCTCGGCATCCTGCGCGGCCGGCGCTGGAACCTGGCCGGGCTCAACG
AGTTCCGCAAGCACTTCGGCCTGCGCGCCTACGCCACCTTCGAGGACATCAACTCGGACCCCGAGGTGGCGGGCG
CGCTGCGGCACCTGTACCAGCACCCGGACCACGTCGAGCTGTACCCGGGCATCGTGGCCGAGGAGGCCAAGACGC
CCATGACGCCGGGCGTCGGCATCGCGCCCACCTACACCATCTCGCGCGTCGTTCTGAGCGACGCCGTCTCGCTCG
TCCGCGGCGACCGCCACTACACCACCGACTACCACCCGGGCTACCTGACCCAGTGGGCCTACAACGAGGTCGACT
ACGACTTCGGCGTCAACCACGGCTGCGTCTTCTACAAGCTCTTCAACCGCGCCTTCCCGCACCACTTCCGTCGCG
ACTCCGTCTACGCCCACTACCCGATGGTGACGCCGGCCGAGAACCGCAAGATCCTGACGGACCTGCGCCGCGTCC
AGCTCTTCAGCTTCGACCGGCCCCGCTTCACGGCCCCACCCGTCGCCGTCGGCTCCGTCGCCGGCATCAAGCACG
TCCTCGGCCACGACGACCGCTACCCCGTCCACTGGCACGCCGGCCTCGACCGCCTCATGGGCCGCGACCGCGCCG
CGCCCCCGCTCGCCGCCGAGCGCCGCCACCTCGACGACCTCATCTACCGCGACAGCTGGCGCGCCTCCATCAAGG
CCTTCTTCGCCGCCGCCGCCGACCGCCTGCTGGCCGACAAGTCGTACCGCCTCGGCGGCCGCCGCCAGTGCGACG
TCGTCCGCGACGTCGGCAACCTGGCCCACACCCACTTCGCCGCCCGCCTCTTCAACCTGCCGCTCAAGTCGGCCG
ACAACCCGCGCGGCGTCTTCTCCGAGCGCGAGCTGTACGACACCCTCGCCACCCTCTTCACCTCCATCTTCTTCG
ACCTCGACCCGGTCAAGTCGTTCCCGCTGCGCCAGCGCGCCCGCGACGCCGCCTCGCGCCTCGCCAGCATCGTCG
AGACCAACGTCAAGATCACCACCACCCTCGGCACCACCGGCCTCTTCACCGGCAAGCCCAAGGACGACAGCCTGG
CCGCCTACGGCGTCAACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail