Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8585
Gene name
LocationContig_57:38553..39805
Strand+
Gene length (bp)1252
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 4.4E-07 54 140
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 2.0E-18 148 346

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 111 133 22
2 153 170 17
3 177 199 22
4 209 231 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8585
MAAEQPAERPASRQESPSDRSAAPKPGAKPSEKSFRGSTRRHQLRSILSQLKWDRHTVAMAIKTAIPPAVLVCAI
QSDPFIHHFQTNAYLAAILSTIPPPALTRASQIQFNFWLALAIAIAYCWALLAGWSGLQARKHTTKDPSRIAEYN
SSAEAVVAIFIIVWIWLVLTLKSARPSLGVQCTLAGIFSVASMPGAARAPTMPKVIAEVSVVVEAFLVGQAVGLV
NALVVFPQSARRNFKKDVRACLDQLVVVMHAHRNCMEDLRLKRSSGGKGNEGSSSGSLLEEALQRFVNGVIKARG
AVEPAEHEMSWGRFDWATLDHISTSLVDLIPATSGLSAMADVLQPAVEDYASANGSSGGDDDQPV*
Coding >Hirsu2|8585
ATGGCCGCCGAGCAGCCGGCCGAGCGCCCCGCCAGCCGCCAGGAATCTCCGTCGGATAGAAGCGCCGCGCCGAAG
CCCGGTGCCAAGCCTTCCGAGAAATCTTTCCGGGGATCAACCCGGCGTCACCAGCTCCGGTCTATCCTTTCTCAG
CTCAAATGGGACCGGCACACGGTTGCCATGGCCATCAAGACGGCAATCCCACCGGCCGTCCTGGTATGTGCCATA
CAGTCGGATCCATTCATCCACCATTTCCAAACAAACGCCTACCTGGCCGCGATCCTGTCCACCATCCCCCCGCCC
GCCCTCACTCGGGCGTCGCAGATCCAGTTCAACTTTTGGTTGGCCTTGGCCATTGCTATTGCGTACTGCTGGGCC
CTCTTGGCGGGCTGGTCTGGTCTGCAGGCCAGGAAGCACACGACCAAGGATCCGAGCAGAATAGCTGAGTACAAT
TCATCGGCCGAGGCCGTCGTCGCCATCTTCATCATCGTTTGGATATGGCTTGTCTTGACCCTGAAGTCGGCCCGG
CCTTCCTTGGGCGTACAGTGCACTCTCGCCGGCATCTTCTCCGTCGCTTCGATGCCTGGGGCCGCCCGCGCTCCC
ACCATGCCGAAAGTCATCGCCGAAGTTAGCGTCGTCGTCGAGGCCTTTCTCGTCGGCCAGGCTGTCGGATTGGTC
AATGCCCTGGTCGTGTTCCCGCAGAGCGCCAGACGGAATTTCAAGAAGGATGTCCGGGCCTGTCTGGATCAGCTG
GTGGTCGTCATGCATGCTCACAGGAACTGCATGGAGGACCTGAGGCTGAAGAGATCCTCTGGAGGGAAGGGAAAT
GAGGGGAGCTCGTCTGGCAGCCTGCTAGAAGAGGCTCTGCAGCGCTTCGTCAACGGCGTCATCAAGGCACGCGGA
GCGGTTGAGCCCGCGGAGCACGAGATGTCGTGGGGCCGGTTCGACTGGGCAACGCTCGACCACATATCCACCTCG
CTGGTAGACCTTATCCCGGCGACTTCTGGCCTGAGCGCCATGGCAGACGTGCTACAGCCGGCTGTGGAAGACTAC
GCCTCCGCCAACGGCTCCAGTGGCGGGGATGACGATCAACCCGTTTGA
Transcript >Hirsu2|8585
ATGGCCGCCGAGCAGCCGGCCGAGCGCCCCGCCAGCCGCCAGGAATCTCCGTCGGATAGAAGCGCCGCGCCGAAG
CCCGGTGCCAAGCCTTCCGAGAAATCTTTCCGGGGATCAACCCGGCGTCACCAGCTCCGGTCTATCCTTTCTCAG
CTCAAATGGGACCGGCACACGGTTGCCATGGCCATCAAGACGGCAATCCCACCGGCCGTCCTGGTATGTGCCATA
CAGTCGGATCCATTCATCCACCATTTCCAAACAAACGCCTACCTGGCCGCGATCCTGTCCACCATCCCCCCGCCC
GCCCTCACTCGGGCGTCGCAGATCCAGTTCAACTTTTGGTTGGCCTTGGCCATTGCTATTGCGTACTGCTGGGCC
CTCTTGGCGGGCTGGTCTGGTCTGCAGGCCAGGAAGCACACGACCAAGGATCCGAGCAGAATAGCTGAGTACAAT
TCATCGGCCGAGGCCGTCGTCGCCATCTTCATCATCGTTTGGATATGGCTTGTCTTGACCCTGAAGTCGGCCCGG
CCTTCCTTGGGCGTACAGTGCACTCTCGCCGGCATCTTCTCCGTCGCTTCGATGCCTGGGGCCGCCCGCGCTCCC
ACCATGCCGAAAGTCATCGCCGAAGTTAGCGTCGTCGTCGAGGCCTTTCTCGTCGGCCAGGCTGTCGGATTGGTC
AATGCCCTGGTCGTGTTCCCGCAGAGCGCCAGACGGAATTTCAAGAAGGATGTCCGGGCCTGTCTGGATCAGCTG
GTGGTCGTCATGCATGCTCACAGGAACTGCATGGAGGACCTGAGGCTGAAGAGATCCTCTGGAGGGAAGGGAAAT
GAGGGGAGCTCGTCTGGCAGCCTGCTAGAAGAGGCTCTGCAGCGCTTCGTCAACGGCGTCATCAAGGCACGCGGA
GCGGTTGAGCCCGCGGAGCACGAGATGTCGTGGGGCCGGTTCGACTGGGCAACGCTCGACCACATATCCACCTCG
CTGGTAGACCTTATCCCGGCGACTTCTGGCCTGAGCGCCATGGCAGACGTGCTACAGCCGGCTGTGGAAGACTAC
GCCTCCGCCAACGGCTCCAGTGGCGGGGATGACGATCAACCCGTTTGA
Gene >Hirsu2|8585
ATGGCCGCCGAGCAGCCGGCCGAGCGCCCCGCCAGCCGCCAGGAATCTCCGTCGGATAGAAGCGCCGCGCCGAAG
CCCGGTGCCAAGCCTTCCGAGAAATCTTTCCGGGGATCAACCCGGCGTCACCAGCTCCGGTCTATCCTTTCTCAG
CTCAAATGGGACCGGCACACGGTTGCCATGGCCATCAAGACGGCAATCCCACCGGCCGTCCTGGTATGTGCCATA
CAGTCGGATCCATTCATCCACCATTTCCAAACAAACGCCTACCTGGCCGCGATCCTGTCCACCATCCCCCCGCCC
GCCCTCACTCGGGCGTCGCAGATCCAGTTCAACTTTTGGTTGGCCTTGGCCATTGCTATTGCGTACTGCTGGGCC
CTCTTGGCGGGCTGGTCTGGTCTGCAGGCCAGGAAGCACACGACCAAGGATCCGAGCAGAATAGCTGAGTACAAT
TCATCGGCCGAGGCCGTCGTCGCCATCTTCATCATCGTTTGGATATGGCTTGTCTTGACCCTGAAGTCGGCCCGG
CCTTCCTTGGGCGTACAGTGCACTCTCGCCGGCATCTTCTCCGTCGCTTCGATGCCTGGGGCCGCCCGCGCTCCC
ACCATGCCGAAAGTCATCGCCGAAGTTAGCGTCGTCGTCGAGGCCTTTCTCGTCGGCCAGGCTGTCGGATTGGTC
AATGCCCTGGTCGTGTTCCCGCAGAGCGCCAGACGGAATTTCAAGAAGGATGTCCGGGCCTGTCTGGATCAGCTG
GTGGTCGTCATGCATGCTCACAGGAACTGCATGGAGGACCTGAGGCTGAAGAGATCCTCTGGAGGGAAGGGAAAT
GAGGGGAGCTCGTCTGGCAGCCTGCTAGAAGAGGCTCTGCAGCGCTTCGTCAACGGCGTCATCAAGGCACGCGGA
GCGGTTGAGCCCGCGGAGCACGAGATGTCGTGGGGCCGGTTCGACTGGGCAACGCTCGACCACATATCCACCTCG
CTGGTAGACCTTATCCCGGCGACTTCTGGCCTGAGCGCCATGGCAGACGTGCTACAGCCGGCTGTGGAAGACTAC
GCCTCCGCCAACGGCTCCAGTGGCGGGGATGACGATCGTGAAAGTGGCAGTGACCCAAAAGACGATGATCGCCGT
CGTCTAGAGGCCACCGTCCATCGGCGCCTCGTTGGTGCATCCGGGGCGATTATCGAAGGAGTGGAGCATATTAAA
ATTCGGCTGCAGGAGACCGACTGGCGCCCCCCGTTTGGAAGAACCCGTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail