Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8564
Gene name
LocationContig_567:15898..16226
Strand-
Gene length (bp)328
Transcript length (bp)246
Coding sequence length (bp)246
Protein length (aa) 82

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03943 TAP_C TAP C-terminal domain 9.3E-18 31 76

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9XVS7|NXF1_CAEEL Nuclear RNA export factor 1 OS=Caenorhabditis elegans GN=nxf-1 PE=1 SV=1 29 77 5.0E-07

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0051028 mRNA transport Yes
GO:0071705 nitrogen compound transport No
GO:0005575 cellular_component No
GO:0044424 intracellular part No
GO:0006810 transport No
GO:0051236 establishment of RNA localization No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0043226 organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0015931 nucleobase-containing compound transport No
GO:0044464 cell part No
GO:0071702 organic substance transport No
GO:0008150 biological_process No
GO:0050658 RNA transport No
GO:0043229 intracellular organelle No
GO:0043227 membrane-bounded organelle No
GO:0050657 nucleic acid transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8564
MLSLRAYSPLPNVFAPAANPAATANGQHQAMIAELAKQTGMVPEYCEMCLSQVEWQFDKALVIFNEKRAELPAEA
FASAHS*
Coding >Hirsu2|8564
ATGTTGTCGCTGAGGGCCTACAGCCCTCTGCCGAACGTCTTCGCACCGGCGGCGAATCCGGCGGCAACCGCGAAC
GGCCAACATCAGGCCATGATTGCGGAGCTGGCGAAGCAGACAGGGATGGTGCCCGAGTACTGCGAGATGTGTCTG
TCGCAGGTCGAGTGGCAGTTTGACAAGGCCCTTGTCATCTTCAACGAAAAGAGGGCTGAGCTGCCGGCCGAGGCC
TTTGCCTCGGCGCACAGCTGA
Transcript >Hirsu2|8564
ATGTTGTCGCTGAGGGCCTACAGCCCTCTGCCGAACGTCTTCGCACCGGCGGCGAATCCGGCGGCAACCGCGAAC
GGCCAACATCAGGCCATGATTGCGGAGCTGGCGAAGCAGACAGGGATGGTGCCCGAGTACTGCGAGATGTGTCTG
TCGCAGGTCGAGTGGCAGTTTGACAAGGCCCTTGTCATCTTCAACGAAAAGAGGGCTGAGCTGCCGGCCGAGGCC
TTTGCCTCGGCGCACAGCTGA
Gene >Hirsu2|8564
ATGTTGTCGCTGAGGGCCTACAGCCCTCTGCCGAACGTCTTCGCACCGGCGGCGAATCCGGCGGCAACCGCGAAC
GGCCAACATCAGGCCATGATTGCGGAGCTGGCGAAGCAGACAGGGATGGTGCCCGAGTACTGCGAGATGTGTCTG
TCGCAGGTCGAGTGGCAGTTTGACAAGGCCCTTGTCATCTTCAACGAAAAGAGGGTGTGTTGCCCCAGCCCCCTC
CCCCCCTCTCCCCGCCCGTGTCACGGCTGGAGTTGAAGATTGCGCTGACGACAGGGAATAGGCTGAGCTGCCGGC
CGAGGCCTTTGCCTCGGCGCACAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail