Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8537
Gene name
LocationContig_563:8845..11498
Strand+
Gene length (bp)2653
Transcript length (bp)1923
Coding sequence length (bp)1923
Protein length (aa) 641

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 6.0E-90 120 573
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-08 157 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 122 570 1.0E-45
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 101 574 2.0E-45
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 101 574 2.0E-45
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 121 574 3.0E-43
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 118 573 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 122 570 1.0E-45
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 101 574 2.0E-45
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 101 574 2.0E-45
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 121 574 3.0E-43
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 118 573 1.0E-42
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 121 573 1.0E-42
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 120 573 5.0E-42
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 62 570 5.0E-42
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 85 570 2.0E-41
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 85 570 2.0E-41
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 112 574 1.0E-40
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 98 570 1.0E-40
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 79 569 2.0E-40
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 75 617 2.0E-39
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 157 573 2.0E-39
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 113 573 2.0E-39
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 129 573 5.0E-39
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 122 570 1.0E-38
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 105 570 2.0E-38
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 121 575 1.0E-37
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 181 582 2.0E-37
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 65 617 2.0E-37
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 77 578 3.0E-37
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 155 619 3.0E-37
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 122 570 3.0E-37
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 174 570 4.0E-37
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 174 570 4.0E-37
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 109 588 5.0E-37
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 157 573 8.0E-37
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 181 582 9.0E-37
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 65 569 1.0E-36
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 122 588 2.0E-36
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 157 573 2.0E-36
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 98 569 4.0E-36
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 182 572 7.0E-36
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 181 582 9.0E-36
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 157 573 1.0E-35
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 181 582 1.0E-35
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 171 570 1.0E-35
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 71 618 2.0E-35
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 71 618 2.0E-35
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 181 582 2.0E-35
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 109 573 3.0E-35
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 153 639 3.0E-35
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 104 572 3.0E-35
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 151 573 3.0E-35
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 181 582 3.0E-35
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 181 582 4.0E-35
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 206 573 4.0E-35
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 122 588 4.0E-35
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 181 582 5.0E-35
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 122 588 6.0E-35
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 181 582 7.0E-35
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 181 582 7.0E-35
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 122 588 9.0E-35
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 122 588 1.0E-34
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 164 582 1.0E-34
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 157 573 1.0E-34
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 157 587 2.0E-34
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 114 597 2.0E-34
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 103 569 3.0E-34
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 157 573 3.0E-34
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 152 573 3.0E-34
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 114 572 4.0E-34
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 172 573 4.0E-34
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 113 574 6.0E-34
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 181 582 7.0E-34
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 157 573 7.0E-34
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 40 573 9.0E-34
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 172 573 9.0E-34
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 155 589 9.0E-34
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 164 582 1.0E-33
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 181 582 1.0E-33
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 122 588 1.0E-33
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 155 589 1.0E-33
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 172 572 1.0E-33
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 105 572 2.0E-33
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 89 590 2.0E-33
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 115 577 2.0E-33
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 109 602 3.0E-33
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 90 617 5.0E-33
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 90 603 5.0E-33
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 103 574 6.0E-33
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 90 617 7.0E-33
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 90 617 9.0E-33
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 173 570 2.0E-32
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 90 578 2.0E-32
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 122 570 3.0E-32
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 114 621 4.0E-32
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 206 569 5.0E-32
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 185 582 7.0E-32
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 155 573 1.0E-31
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 164 570 1.0E-31
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 78 573 1.0E-31
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 155 573 1.0E-31
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 157 573 1.0E-31
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 95 612 1.0E-31
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 216 585 2.0E-31
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 155 578 2.0E-31
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 109 583 2.0E-31
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 114 578 2.0E-31
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 184 573 3.0E-31
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 174 570 4.0E-31
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 156 575 5.0E-31
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 109 583 5.0E-31
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 157 573 5.0E-31
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 114 578 7.0E-31
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 164 570 7.0E-31
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 157 573 7.0E-31
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 89 573 2.0E-30
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 164 570 2.0E-30
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 182 573 2.0E-30
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 172 571 3.0E-30
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 187 589 3.0E-30
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 156 575 5.0E-30
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 171 569 7.0E-30
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 187 589 8.0E-30
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 216 569 8.0E-30
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 99 618 9.0E-30
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 157 573 1.0E-29
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 105 574 2.0E-29
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 153 583 2.0E-29
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 79 570 2.0E-29
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 64 573 2.0E-29
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 157 573 2.0E-29
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 116 573 4.0E-29
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 174 570 5.0E-29
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 168 579 7.0E-29
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 122 573 7.0E-29
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 174 570 7.0E-29
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 122 573 9.0E-29
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 105 572 1.0E-28
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 116 569 1.0E-28
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 173 589 1.0E-28
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 181 582 1.0E-28
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 174 570 1.0E-28
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 157 573 2.0E-28
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 157 573 2.0E-28
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 173 589 2.0E-28
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 113 573 2.0E-28
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 114 574 4.0E-28
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 113 573 4.0E-28
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 216 512 5.0E-28
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 155 640 5.0E-28
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 172 570 6.0E-28
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 155 606 6.0E-28
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 109 569 1.0E-27
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 173 573 1.0E-27
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 157 573 1.0E-27
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 169 570 3.0E-27
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 166 579 4.0E-27
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 166 579 4.0E-27
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 113 573 6.0E-27
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 157 573 9.0E-27
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 158 583 2.0E-26
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 91 570 2.0E-26
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 181 573 7.0E-26
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 103 572 9.0E-26
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 183 471 1.0E-25
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 122 570 2.0E-25
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 114 569 2.0E-25
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 111 572 3.0E-25
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 118 561 3.0E-25
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 115 569 4.0E-25
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 112 450 4.0E-25
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 113 573 6.0E-25
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 183 436 1.0E-24
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 175 570 2.0E-24
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 93 450 2.0E-24
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 173 573 2.0E-24
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 181 573 3.0E-24
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 162 570 1.0E-23
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 102 574 1.0E-23
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 101 436 1.0E-23
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 156 570 2.0E-23
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 179 570 3.0E-23
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 183 455 4.0E-23
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 122 570 8.0E-23
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 181 573 9.0E-23
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 181 573 9.0E-23
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 227 573 7.0E-22
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 114 570 1.0E-21
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 227 573 2.0E-21
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 173 570 4.0E-21
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 113 573 4.0E-21
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 154 570 5.0E-21
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 173 573 5.0E-21
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 173 570 5.0E-21
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 114 574 8.0E-21
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 157 521 8.0E-21
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 182 580 1.0E-20
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 156 570 3.0E-20
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 112 357 7.0E-20
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 184 456 1.0E-19
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 173 570 1.0E-19
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 227 573 2.0E-19
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 227 573 5.0E-19
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 148 614 1.0E-18
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 160 561 1.0E-17
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 173 438 2.0E-17
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 364 584 2.0E-16
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 159 529 2.0E-16
sp|P46408|GTR5_RABIT Solute carrier family 2, facilitated glucose transporter member 5 OS=Oryctolagus cuniculus GN=SLC2A5 PE=2 SV=1 157 590 3.0E-16
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 125 576 3.0E-16
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 173 582 2.0E-15
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 116 320 2.0E-15
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 154 456 4.0E-15
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 124 355 5.0E-15
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 364 574 3.0E-14
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 168 585 6.0E-14
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 168 585 7.0E-14
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 364 579 5.0E-13
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 364 573 7.0E-13
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 122 348 1.0E-12
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 168 585 1.0E-12
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 168 585 1.0E-12
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 168 585 1.0E-12
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 168 585 2.0E-12
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 168 585 2.0E-12
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 169 456 5.0E-12
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 125 568 5.0E-12
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 112 456 7.0E-12
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 112 456 2.0E-11
sp|P53403|GTR3_DROME Glucose transporter type 3 OS=Drosophila melanogaster GN=Glut3 PE=2 SV=1 70 514 3.0E-11
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 168 570 4.0E-11
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 470 573 5.0E-11
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 470 573 5.0E-11
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 112 456 7.0E-11
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 470 573 1.0E-10
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 148 568 5.0E-10
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 114 570 1.0E-09
sp|O62787|GTR3_PIG Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Sus scrofa GN=SLC2A3 PE=2 SV=1 219 321 2.0E-09
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 472 575 4.0E-09
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 128 511 4.0E-09
sp|Q864Z3|S22A6_BOVIN Solute carrier family 22 member 6 OS=Bos taurus GN=SLC22A6 PE=2 SV=2 151 512 4.0E-08
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 250 511 8.0E-08
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 166 561 8.0E-08
sp|Q8MK48|S22A6_PIG Solute carrier family 22 member 6 OS=Sus scrofa GN=SLC22A6 PE=1 SV=2 168 512 9.0E-08
sp|O70577|S22A2_MOUSE Solute carrier family 22 member 2 OS=Mus musculus GN=Slc22a2 PE=1 SV=1 95 537 2.0E-07
sp|O02713|S22A2_PIG Solute carrier family 22 member 2 OS=Sus scrofa GN=SLC22A2 PE=2 SV=1 163 568 3.0E-07
sp|Q4U2R8|S22A6_HUMAN Solute carrier family 22 member 6 OS=Homo sapiens GN=SLC22A6 PE=1 SV=1 168 512 3.0E-07
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 472 570 5.0E-07
sp|Q5RCH6|S22A6_PONAB Solute carrier family 22 member 6 OS=Pongo abelii GN=SLC22A6 PE=2 SV=1 168 512 8.0E-07
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 250 511 8.0E-07
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 128 511 9.0E-07
sp|Q9R0W2|S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus GN=Slc22a2 PE=1 SV=1 95 537 1.0E-06
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 128 511 1.0E-06
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 250 511 1.0E-06
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 123 568 1.0E-06
sp|Q4W8A3|S22A6_MACFA Solute carrier family 22 member 6 OS=Macaca fascicularis GN=SLC22A6 PE=1 SV=1 168 512 2.0E-06
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 146 512 2.0E-06
sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 SV=2 470 573 2.0E-06
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 173 510 2.0E-06
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 163 568 3.0E-06
sp|O57379|S22A6_PSEAM Solute carrier family 22 member 6 OS=Pseudopleuronectes americanus GN=SLC22A6 PE=1 SV=1 168 511 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 190 212 22
2 255 274 19
3 279 301 22
4 369 391 22
5 406 428 22
6 435 457 22
7 467 489 22
8 509 531 22
9 536 558 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8537
MAEIRPEPKAHHHGEHLEEKGVTHTEEVDLSRNLEAKIRNPLEGISREQLMRDVEAFAEYRGLQEHVSLLKKGAL
VAQNPTEPHTIDGDEKLEPDELDALEVERNHRWRMPMRLFLTIATCSIGAAVQGWDQTGSNGATIFFPHVYGLDP
EHKNRDSLIVGLLNAGPYIGSSLIGCWLSDPLNNYLGRRGTIFFSAHFCIWPVIGSALCRTWEQQMACRLLMGIG
MGAKASTVPIYAAENAPASIRGALVMSWQMWTAFGILLGTAFNLAVFYVKDINWRLMLGAPFLPAVPLLLLIYLC
PESPRWYMKKNRYPQAWKSLLVLRNHPIQVARDIYYISAQLEIEKQLVGKTNYISRFTQLFTVPRVRRANLAAFT
VMIAQQMCGINIIAFYSTTIFVDAGLGNFKAMIGSFGFGLVNWLFAFPAFWTIDTFGRRSLLLFTFPQMFWTLLV
AGLCTLMPTGTPEDPNNARTALVCLFVFLFGAFYSPGEGPVPFTYSAEVYPLSHRETGMGFAVATCLFWAAVLGT
SFPFVLKQLHTVGAFGLYAGFNVVAFIMIFLWVPETMQRTLEELDYVFAVPVRKFAAYQITETIPWFFKKYILFQ
RDATRPPLYDFEHESVPMTPSTDVSATETFIPGTDEDRKY*
Coding >Hirsu2|8537
ATGGCAGAAATTCGGCCGGAGCCCAAGGCCCATCACCATGGGGAGCACTTGGAGGAGAAGGGCGTCACTCACACC
GAAGAGGTCGACCTCAGCAGAAACCTCGAGGCCAAGATCCGAAATCCCCTCGAAGGCATTTCTCGTGAGCAACTC
ATGCGTGATGTCGAGGCCTTCGCCGAGTACCGTGGCCTGCAAGAGCACGTTTCCCTTCTCAAGAAGGGCGCCCTC
GTAGCCCAAAATCCCACCGAACCGCATACCATCGATGGCGACGAGAAACTGGAACCAGACGAGCTCGACGCCCTG
GAAGTGGAGAGGAATCACCGTTGGCGTATGCCCATGCGCCTCTTCCTGACGATAGCCACTTGCTCCATCGGTGCC
GCCGTCCAGGGCTGGGATCAGACGGGCAGCAACGGCGCCACCATCTTCTTCCCTCACGTCTATGGCCTCGACCCC
GAGCACAAGAACCGTGATTCCCTCATCGTCGGTCTCCTGAATGCCGGACCGTATATTGGTAGCTCTCTCATCGGA
TGCTGGCTTTCCGACCCTCTTAACAACTATCTCGGCCGTCGAGGCACGATATTCTTCTCCGCCCACTTCTGTATC
TGGCCTGTCATCGGCTCTGCCCTATGCCGCACTTGGGAACAGCAAATGGCCTGTCGTCTTCTGATGGGTATCGGT
ATGGGTGCCAAGGCGTCCACAGTACCCATCTACGCCGCCGAGAACGCTCCCGCCTCCATTCGAGGAGCTCTCGTC
ATGTCATGGCAAATGTGGACCGCTTTTGGCATCTTGCTCGGAACCGCCTTCAACCTGGCCGTCTTCTATGTCAAG
GATATCAATTGGCGACTGATGCTTGGCGCCCCTTTCCTTCCCGCCGTCCCGCTGCTGCTTCTCATCTATCTCTGC
CCCGAGTCGCCGCGTTGGTACATGAAGAAGAATCGCTACCCCCAGGCCTGGAAGTCTTTACTGGTCCTGCGGAAT
CACCCGATCCAGGTGGCCCGAGACATCTACTATATCAGCGCCCAGCTGGAGATTGAGAAGCAGCTTGTCGGAAAG
ACGAACTACATCTCGCGATTCACTCAGCTTTTCACTGTCCCCCGCGTCCGACGAGCCAACCTGGCTGCCTTCACC
GTCATGATTGCGCAGCAGATGTGCGGCATCAACATCATCGCCTTCTACTCGACCACCATTTTCGTCGATGCTGGT
CTCGGAAACTTCAAGGCCATGATCGGGTCGTTCGGCTTCGGTCTCGTCAACTGGCTGTTTGCCTTCCCTGCCTTC
TGGACCATTGACACCTTTGGTCGACGGAGCTTGCTTCTCTTCACATTCCCCCAAATGTTTTGGACATTGCTCGTC
GCTGGTCTCTGCACTCTCATGCCGACAGGAACCCCCGAGGACCCCAACAACGCGAGAACAGCCCTCGTCTGTCTG
TTTGTCTTCCTCTTCGGCGCTTTCTACTCCCCCGGCGAGGGCCCGGTGCCGTTCACGTACAGCGCGGAGGTCTAT
CCCCTATCTCACAGGGAGACTGGCATGGGCTTCGCGGTCGCCACATGCTTGTTCTGGGCTGCTGTGCTGGGAACG
TCGTTCCCCTTCGTACTCAAGCAACTGCATACCGTGGGCGCATTCGGCCTGTACGCGGGCTTCAACGTCGTGGCC
TTTATCATGATCTTCCTCTGGGTCCCGGAGACGATGCAGCGCACGCTCGAGGAGCTGGACTACGTCTTCGCCGTA
CCGGTTCGCAAGTTCGCCGCGTACCAAATCACGGAAACAATCCCGTGGTTCTTCAAGAAGTACATTCTCTTCCAG
AGGGACGCGACGAGGCCGCCGCTGTACGACTTCGAACACGAAAGCGTGCCCATGACGCCCAGCACGGACGTGTCT
GCCACTGAAACCTTCATTCCCGGCACCGACGAAGATCGGAAGTACTGA
Transcript >Hirsu2|8537
ATGGCAGAAATTCGGCCGGAGCCCAAGGCCCATCACCATGGGGAGCACTTGGAGGAGAAGGGCGTCACTCACACC
GAAGAGGTCGACCTCAGCAGAAACCTCGAGGCCAAGATCCGAAATCCCCTCGAAGGCATTTCTCGTGAGCAACTC
ATGCGTGATGTCGAGGCCTTCGCCGAGTACCGTGGCCTGCAAGAGCACGTTTCCCTTCTCAAGAAGGGCGCCCTC
GTAGCCCAAAATCCCACCGAACCGCATACCATCGATGGCGACGAGAAACTGGAACCAGACGAGCTCGACGCCCTG
GAAGTGGAGAGGAATCACCGTTGGCGTATGCCCATGCGCCTCTTCCTGACGATAGCCACTTGCTCCATCGGTGCC
GCCGTCCAGGGCTGGGATCAGACGGGCAGCAACGGCGCCACCATCTTCTTCCCTCACGTCTATGGCCTCGACCCC
GAGCACAAGAACCGTGATTCCCTCATCGTCGGTCTCCTGAATGCCGGACCGTATATTGGTAGCTCTCTCATCGGA
TGCTGGCTTTCCGACCCTCTTAACAACTATCTCGGCCGTCGAGGCACGATATTCTTCTCCGCCCACTTCTGTATC
TGGCCTGTCATCGGCTCTGCCCTATGCCGCACTTGGGAACAGCAAATGGCCTGTCGTCTTCTGATGGGTATCGGT
ATGGGTGCCAAGGCGTCCACAGTACCCATCTACGCCGCCGAGAACGCTCCCGCCTCCATTCGAGGAGCTCTCGTC
ATGTCATGGCAAATGTGGACCGCTTTTGGCATCTTGCTCGGAACCGCCTTCAACCTGGCCGTCTTCTATGTCAAG
GATATCAATTGGCGACTGATGCTTGGCGCCCCTTTCCTTCCCGCCGTCCCGCTGCTGCTTCTCATCTATCTCTGC
CCCGAGTCGCCGCGTTGGTACATGAAGAAGAATCGCTACCCCCAGGCCTGGAAGTCTTTACTGGTCCTGCGGAAT
CACCCGATCCAGGTGGCCCGAGACATCTACTATATCAGCGCCCAGCTGGAGATTGAGAAGCAGCTTGTCGGAAAG
ACGAACTACATCTCGCGATTCACTCAGCTTTTCACTGTCCCCCGCGTCCGACGAGCCAACCTGGCTGCCTTCACC
GTCATGATTGCGCAGCAGATGTGCGGCATCAACATCATCGCCTTCTACTCGACCACCATTTTCGTCGATGCTGGT
CTCGGAAACTTCAAGGCCATGATCGGGTCGTTCGGCTTCGGTCTCGTCAACTGGCTGTTTGCCTTCCCTGCCTTC
TGGACCATTGACACCTTTGGTCGACGGAGCTTGCTTCTCTTCACATTCCCCCAAATGTTTTGGACATTGCTCGTC
GCTGGTCTCTGCACTCTCATGCCGACAGGAACCCCCGAGGACCCCAACAACGCGAGAACAGCCCTCGTCTGTCTG
TTTGTCTTCCTCTTCGGCGCTTTCTACTCCCCCGGCGAGGGCCCGGTGCCGTTCACGTACAGCGCGGAGGTCTAT
CCCCTATCTCACAGGGAGACTGGCATGGGCTTCGCGGTCGCCACATGCTTGTTCTGGGCTGCTGTGCTGGGAACG
TCGTTCCCCTTCGTACTCAAGCAACTGCATACCGTGGGCGCATTCGGCCTGTACGCGGGCTTCAACGTCGTGGCC
TTTATCATGATCTTCCTCTGGGTCCCGGAGACGATGCAGCGCACGCTCGAGGAGCTGGACTACGTCTTCGCCGTA
CCGGTTCGCAAGTTCGCCGCGTACCAAATCACGGAAACAATCCCGTGGTTCTTCAAGAAGTACATTCTCTTCCAG
AGGGACGCGACGAGGCCGCCGCTGTACGACTTCGAACACGAAAGCGTGCCCATGACGCCCAGCACGGACGTGTCT
GCCACTGAAACCTTCATTCCCGGCACCGACGAAGATCGGAAGTACTGA
Gene >Hirsu2|8537
ATGGCAGAAATTCGGTATTGACGGGCTCCTCCTGGACCTGCTTCTTCGGCGTGACATGTTGCTGACCTACGATGC
CTGCAGGCCGGAGCCCAAGGCCCATCACCATGGGGAGCACTTGGAGGAGAAGGGCGTCACTCACACCGAAGAGGT
CGACCTCAGCAGAAACCTCGAGGCCAAGTACGTCAGAGATTGGAAGGGCTGGCGGTTTGGGTGTTTAGCCGGAAA
CCGAGACTAACTTGCAGCGATAGGATCCGAAATCCCCTCGAAGGCATTTCTCGTGAGCAACTCATGCGTGATGTC
GAGGCCTTCGCCGAGTACCGTGGCCTGCAAGAGCACGTTTCCCTTCTCAAGAAGGGCGCCCTCGTAGCCCAAAAT
CCCACCGAACCGCATACCATCGATGGCGACGAGAAACTGGAACCAGACGAGCTCGACGCCCTGGAAGTGGAGAGG
AATCACCGTTGGCGTATGCCCATGCGCCTCTTCCTGACGATAGCCACTTGCTCCATCGGTGCCGCCGTCCAGGGC
TGGGATCAGACGGGCAGCAACGGCGCCACCATCTTCTTCCCTCACGTCTATGGCCTCGACCCCGAGCACAAGAAC
CGTGATTCCCTCATCGTCGGTCTCCTGAATGCCGGACCGTATATTGGTAGCTCGTACGTCCCCTACCGGCCTGTT
CCCATGCCACGTTCTTGCTTGGGCCTCGGTTAACGTGACGACGCTTCAGTCTCATCGGATGCTGGCTTTCCGACC
CTCTTAACAACTATCTCGGCCGTCGAGGTGAGCTTCCAGCAGCCTCAACGAGGGAGGCCCCGGCCCTCCCCGTCA
TCTGACGCTAACCTTGCCCAAGGCACGATATTCTTCTCCGCCCACTTCTGTATCTGGCCTGTCATCGGCTCTGCC
CTATGCCGCACTTGGGAACAGCAAATGGCCTGTCGTCTTCTGATGGGTATCGGTATGGGTGCCAAGGCGTCCACA
GTACCCATCTACGCCGCCGAGAACGCTCCCGCCTCCATTCGAGGAGCTCTCGTCATGTCATGGCGTATGTGGCAC
GCGCCGGCCCCCTCCCCCGACGTCTGTCTCAGCCGTTAACATGAAAGGACAGAAATGTGGACCGCTTTTGGCATC
TTGCTCGGAACCGCCTTCAACCTGGCCGTCTTCTATGTCAAGGATATCAATTGGCGACTGATGCTTGGTAAGACA
CGGCCGATTGGACGCGACGGACACTCGTTGGTAGACGCTGACACGCCGGCACTGTAGGCGCCCCTTTCCTTCCCG
CCGTCCCGCTGCTGCTTCTCATCTATCTCTGCCCCGAGTCGCCGCGTTGGTACATGAAGAAGAATCGCTACCCCC
AGGCCTGGAAGTCTTTACTGGTCCTGCGGAATCACCCGATCCAGGTGGCCCGAGACATCTACTATATCAGCGCCC
AGCTGGAGATTGAGAAGCAGCTTGTCGGAAAGACGAACTACATCTCGCGATTCACTCAGCTTTTCACTGTCCCCC
GCGTCCGACGAGCCAACCTGGCTGCCTTCACCGTCATGATTGCGCAGCAGATGTGCGGTAGGTCAACTCCGTTCT
CGGCAGCGCCCTTCTGCGGGCAGCCTTGGCGCACTCGGACTTTGCAGACTGACGTCTCTCGACCCAGGCATCAAC
ATCATCGCCTTCTACTCGACCACCATTTTCGTCGATGCTGGTCTCGGAAACTTCAAGGCCATGATCGGGTCGTTC
GGCTTCGGTCTCGTCAACTGGCTGTTTGCCTTCCCTGCCTTCTGGACCATTGACACCGTACGCCGTTTCCCAACT
CGCGCAAAACGGCTGGGTTTGCTGACTGTTCTCGCTAGTTTGGTCGACGGAGCTTGCTTCTCTTCACATTCCCCC
AAATGGTATGTCGGCTCAAGCTTTGCAACTATAGCCGAACATTTGTCTGACCTTTCTTCACCAGTTTTGGACATT
GCTCGTCGCTGGTCTCTGCACTCTCATGCCGACAGGAACCCCCGAGGACCCCAACAACGCGAGAACAGCCCTCGT
CTGTCTGTTTGTCTTCCTCTTCGGCGGTATGTGATGATGATATCTGGTTACTACTTCTGTCCGGTGAATTCGACA
GCTGACGCCGACACGGCAGCTTTCTACTCCCCCGGCGAGGGCCCGGTGCCGTTCACGTACAGCGCGGAGGTCTAT
CCCCTATCTCACAGGGAGACTGGCATGGGCTTCGCGGTCGCCACATGCTTGTTCTGGGTATGCCGAGCCCCGCCG
CCCCGGATCGGTTGAAGTTTTGCTGACAGTGGTTCAGGCTGCTGTGCTGGGAACGTCGTTCCCCTTCGTACTCAA
GCAACTGCATACCGTGGGCGCATTCGGCCTGTACGCGGGCTTCAACGTCGTGGCCTTTATCATGATCTTCCTCTG
GGTCCCGGAGACGATGCAGCGCACGCTCGAGGAGCTGGACTACGTCTTCGCCGTACCGGTTCGCAAGTTCGCCGC
GTACCAAATCACGGAAACAATCCCGTGGTTCTTCAAGAAGTACATTCTCTTCCAGAGGGACGCGACGAGGCCGCC
GCTGTACGACTTCGAACACGAAAGCGTGCCCATGACGCCCAGCACGGACGTGTCTGCCACTGAAACCTTCATTCC
CGGCACCGACGAAGATCGGAAGTACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail