Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8522
Gene name
LocationContig_561:6621..6987
Strand+
Gene length (bp)366
Transcript length (bp)366
Coding sequence length (bp)366
Protein length (aa) 122

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J207|ERG3_LEPMC Delta(7)-sterol 5(6)-desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1 1 80 2.0E-19
sp|Q7SBB6|ERG3_NEUCR Probable Delta(7)-sterol 5(6)-desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06207 PE=3 SV=1 1 80 8.0E-17
sp|O94457|ERG31_SCHPO Delta(7)-sterol 5(6)-desaturase erg31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg31 PE=3 SV=1 4 94 1.0E-12
sp|O13666|ERG32_SCHPO Delta(7)-sterol 5(6)-desaturase erg32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg32 PE=3 SV=1 4 80 8.0E-11
sp|Q8NJ57|ERG3_CANDC Delta(7)-sterol 5(6)-desaturase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ERG3 PE=3 SV=1 1 80 9.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J207|ERG3_LEPMC Delta(7)-sterol 5(6)-desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1 1 80 2.0E-19
sp|Q7SBB6|ERG3_NEUCR Probable Delta(7)-sterol 5(6)-desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06207 PE=3 SV=1 1 80 8.0E-17
sp|O94457|ERG31_SCHPO Delta(7)-sterol 5(6)-desaturase erg31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg31 PE=3 SV=1 4 94 1.0E-12
sp|O13666|ERG32_SCHPO Delta(7)-sterol 5(6)-desaturase erg32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg32 PE=3 SV=1 4 80 8.0E-11
sp|Q8NJ57|ERG3_CANDC Delta(7)-sterol 5(6)-desaturase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ERG3 PE=3 SV=1 1 80 9.0E-10
sp|O93875|ERG3_CANAX Delta(7)-sterol 5(6)-desaturase OS=Candida albicans GN=ERG3 PE=3 SV=1 1 80 1.0E-08
sp|O75845|SC5D_HUMAN Lathosterol oxidase OS=Homo sapiens GN=SC5D PE=1 SV=2 1 82 4.0E-08
sp|P50860|ERG3_CANGA Delta(7)-sterol 5(6)-desaturase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG3 PE=3 SV=1 1 80 4.0E-08
sp|P32353|ERG3_YEAST Delta(7)-sterol 5(6)-desaturase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG3 PE=1 SV=1 1 80 6.0E-08
sp|Q754B9|ERG3_ASHGO Delta(7)-sterol 5(6)-desaturase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG3 PE=3 SV=2 1 80 7.0E-08
sp|Q9EQS5|SC5D_RAT Lathosterol oxidase OS=Rattus norvegicus GN=Sc5d PE=1 SV=1 4 82 2.0E-07
sp|O88822|SC5D_MOUSE Lathosterol oxidase OS=Mus musculus GN=Sc5d PE=2 SV=2 4 82 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8522
MRDSLTALLGLNLLTVPIFVAQVRGYSKLYDRGDGSVSRWYEAAQYPFFVLFSDTAMYWQHRLFHHPFLFNAMHK
KHHRYDLDEGMSGRPLPSATLGNRIADTLSRRHSRHTHSTRWKHGS*
Coding >Hirsu2|8522
ATGCGGGATTCGCTCACGGCTCTCCTTGGGCTGAACCTCCTGACCGTACCGATTTTCGTCGCCCAAGTCCGCGGA
TACTCCAAGCTCTACGACAGGGGTGATGGTAGTGTGTCGCGATGGTACGAAGCGGCACAGTATCCCTTCTTCGTG
CTGTTTAGCGACACCGCCATGTACTGGCAGCACCGCTTGTTCCACCACCCTTTCCTTTTCAACGCCATGCACAAG
AAGCATCATCGGTATGACCTCGACGAGGGCATGAGTGGACGGCCGCTGCCGTCTGCAACTTTGGGTAACCGAATC
GCAGATACATTATCCCGACGCCATTCTCGGCATACGCATTCGACCCGCTGGAAGCATGGATCATGA
Transcript >Hirsu2|8522
ATGCGGGATTCGCTCACGGCTCTCCTTGGGCTGAACCTCCTGACCGTACCGATTTTCGTCGCCCAAGTCCGCGGA
TACTCCAAGCTCTACGACAGGGGTGATGGTAGTGTGTCGCGATGGTACGAAGCGGCACAGTATCCCTTCTTCGTG
CTGTTTAGCGACACCGCCATGTACTGGCAGCACCGCTTGTTCCACCACCCTTTCCTTTTCAACGCCATGCACAAG
AAGCATCATCGGTATGACCTCGACGAGGGCATGAGTGGACGGCCGCTGCCGTCTGCAACTTTGGGTAACCGAATC
GCAGATACATTATCCCGACGCCATTCTCGGCATACGCATTCGACCCGCTGGAAGCATGGATCATGA
Gene >Hirsu2|8522
ATGCGGGATTCGCTCACGGCTCTCCTTGGGCTGAACCTCCTGACCGTACCGATTTTCGTCGCCCAAGTCCGCGGA
TACTCCAAGCTCTACGACAGGGGTGATGGTAGTGTGTCGCGATGGTACGAAGCGGCACAGTATCCCTTCTTCGTG
CTGTTTAGCGACACCGCCATGTACTGGCAGCACCGCTTGTTCCACCACCCTTTCCTTTTCAACGCCATGCACAAG
AAGCATCATCGGTATGACCTCGACGAGGGCATGAGTGGACGGCCGCTGCCGTCTGCAACTTTGGGTAACCGAATC
GCAGATACATTATCCCGACGCCATTCTCGGCATACGCATTCGACCCGCTGGAAGCATGGATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail