Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8521
Gene name
LocationContig_561:4102..5550
Strand-
Gene length (bp)1448
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 1.1E-06 19 162
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 1.0E-08 203 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SXF1|DHCR7_DANRE 7-dehydrocholesterol reductase OS=Danio rerio GN=dhcr7 PE=2 SV=1 3 347 9.0E-31
sp|Q7ZXH1|DHCR7_XENLA 7-dehydrocholesterol reductase OS=Xenopus laevis GN=dhcr7 PE=2 SV=1 22 347 8.0E-27
sp|Q6P4M0|DHCR7_XENTR 7-dehydrocholesterol reductase OS=Xenopus tropicalis GN=dhcr7 PE=2 SV=1 17 347 6.0E-26
sp|Q9LDU6|ST7R_ARATH 7-dehydrocholesterol reductase OS=Arabidopsis thaliana GN=DWF5 PE=1 SV=1 13 307 9.0E-24
sp|Q9UBM7|DHCR7_HUMAN 7-dehydrocholesterol reductase OS=Homo sapiens GN=DHCR7 PE=1 SV=1 75 307 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SXF1|DHCR7_DANRE 7-dehydrocholesterol reductase OS=Danio rerio GN=dhcr7 PE=2 SV=1 3 347 9.0E-31
sp|Q7ZXH1|DHCR7_XENLA 7-dehydrocholesterol reductase OS=Xenopus laevis GN=dhcr7 PE=2 SV=1 22 347 8.0E-27
sp|Q6P4M0|DHCR7_XENTR 7-dehydrocholesterol reductase OS=Xenopus tropicalis GN=dhcr7 PE=2 SV=1 17 347 6.0E-26
sp|Q9LDU6|ST7R_ARATH 7-dehydrocholesterol reductase OS=Arabidopsis thaliana GN=DWF5 PE=1 SV=1 13 307 9.0E-24
sp|Q9UBM7|DHCR7_HUMAN 7-dehydrocholesterol reductase OS=Homo sapiens GN=DHCR7 PE=1 SV=1 75 307 1.0E-22
sp|Q5E9J5|DHCR7_BOVIN 7-dehydrocholesterol reductase OS=Bos taurus GN=DHCR7 PE=2 SV=1 62 347 2.0E-22
sp|O88455|DHCR7_MOUSE 7-dehydrocholesterol reductase OS=Mus musculus GN=Dhcr7 PE=1 SV=1 22 347 1.0E-21
sp|Q9Z2Z8|DHCR7_RAT 7-dehydrocholesterol reductase OS=Rattus norvegicus GN=Dhcr7 PE=2 SV=1 62 347 3.0E-21
sp|Q5UQI4|DHCR7_MIMIV Probable 7-dehydrocholesterol reductase OS=Acanthamoeba polyphaga mimivirus GN=DHCR7 PE=3 SV=1 8 307 3.0E-15
sp|Q54PP1|ERG24_DICDI Delta(14)-sterol reductase OS=Dictyostelium discoideum GN=erg24 PE=3 SV=1 27 307 7.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 74 96 22
3 109 131 22
4 141 160 19
5 211 229 18
6 239 261 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8521
MYEPRVTGRTKVLLNEALSMALITGSPILLLFYWITYNFFDASLSASGAALLHEGAATFFLSRLPWPTISSLKGY
GFWVVSQALLYHFLPGALHLAPRTPGGRRLLYRLNGLLAWFLTVAVAAAASYFGTLDPTVIAKQWGEGLATANVY
ALTLVGVFYVKARVRPDEPGDTLFTGECRTPYAASPKLTKRCGRAFLIRFYETLDGAHERFSFYSIYGFAAMMPQ
LWTLQTQYLAKHPVDLSYGVIAGTIALFALGWMLNHDANRQKSLSRQTAGRCVIWGAPAQFLEATYKTADGKTHR
TVLLCSGNTPPAVQPLTTADTYSQAGGGWCGMQTTSGHSCIPGPHACHAASITSYRTLKQSS*
Coding >Hirsu2|8521
ATGTATGAGCCAAGAGTCACAGGTCGGACCAAGGTCCTCCTCAACGAAGCTCTAAGTATGGCTCTTATCACAGGG
AGTCCCATTCTGCTTCTTTTCTATTGGATCACGTACAACTTCTTCGACGCCTCGCTCTCGGCAAGCGGAGCAGCT
CTGCTCCATGAAGGCGCAGCCACGTTCTTTTTGTCGCGCCTGCCATGGCCGACGATTTCTTCACTCAAGGGCTAC
GGGTTTTGGGTTGTTTCTCAAGCTCTGCTATATCATTTCCTGCCAGGTGCTCTCCATCTTGCACCCCGGACCCCT
GGCGGAAGACGGCTACTTTACAGATTGAACGGGCTTCTCGCCTGGTTCCTGACCGTTGCGGTTGCGGCTGCAGCC
TCTTACTTTGGGACTTTGGACCCTACAGTTATCGCAAAACAATGGGGAGAAGGCTTAGCGACCGCCAACGTTTAC
GCACTCACCTTGGTGGGCGTCTTCTATGTCAAGGCTCGCGTTAGACCAGACGAACCTGGAGACACGCTATTCACA
GGCGAGTGCCGTACACCGTACGCTGCTTCCCCCAAGCTCACAAAAAGATGCGGTAGGGCATTTCTGATCAGGTTC
TACGAAACGCTAGACGGCGCCCACGAGCGGTTCTCCTTCTACAGCATCTACGGCTTTGCTGCCATGATGCCGCAG
CTATGGACCCTACAGACGCAATACTTGGCGAAGCACCCAGTGGACCTGTCATACGGCGTCATTGCCGGCACTATC
GCTTTGTTTGCTTTGGGGTGGATGCTGAACCACGATGCAAACCGACAGAAGAGCCTGTCGAGGCAAACTGCCGGA
CGGTGCGTCATCTGGGGAGCGCCCGCCCAGTTCCTCGAAGCGACCTATAAGACTGCCGACGGAAAGACGCACCGA
ACAGTCTTACTATGCTCCGGTAACACGCCGCCCGCAGTCCAGCCTCTGACAACAGCTGATACGTATAGCCAGGCT
GGTGGGGGATGGTGCGGCATGCAAACTACGTCGGGTCACTCCTGTATACCTGGGCCTCATGCGTGTCATGCGGCT
TCGATCACCTCTTACCGTACACTGAAGCAATCATCGTGA
Transcript >Hirsu2|8521
ATGTATGAGCCAAGAGTCACAGGTCGGACCAAGGTCCTCCTCAACGAAGCTCTAAGTATGGCTCTTATCACAGGG
AGTCCCATTCTGCTTCTTTTCTATTGGATCACGTACAACTTCTTCGACGCCTCGCTCTCGGCAAGCGGAGCAGCT
CTGCTCCATGAAGGCGCAGCCACGTTCTTTTTGTCGCGCCTGCCATGGCCGACGATTTCTTCACTCAAGGGCTAC
GGGTTTTGGGTTGTTTCTCAAGCTCTGCTATATCATTTCCTGCCAGGTGCTCTCCATCTTGCACCCCGGACCCCT
GGCGGAAGACGGCTACTTTACAGATTGAACGGGCTTCTCGCCTGGTTCCTGACCGTTGCGGTTGCGGCTGCAGCC
TCTTACTTTGGGACTTTGGACCCTACAGTTATCGCAAAACAATGGGGAGAAGGCTTAGCGACCGCCAACGTTTAC
GCACTCACCTTGGTGGGCGTCTTCTATGTCAAGGCTCGCGTTAGACCAGACGAACCTGGAGACACGCTATTCACA
GGCGAGTGCCGTACACCGTACGCTGCTTCCCCCAAGCTCACAAAAAGATGCGGTAGGGCATTTCTGATCAGGTTC
TACGAAACGCTAGACGGCGCCCACGAGCGGTTCTCCTTCTACAGCATCTACGGCTTTGCTGCCATGATGCCGCAG
CTATGGACCCTACAGACGCAATACTTGGCGAAGCACCCAGTGGACCTGTCATACGGCGTCATTGCCGGCACTATC
GCTTTGTTTGCTTTGGGGTGGATGCTGAACCACGATGCAAACCGACAGAAGAGCCTGTCGAGGCAAACTGCCGGA
CGGTGCGTCATCTGGGGAGCGCCCGCCCAGTTCCTCGAAGCGACCTATAAGACTGCCGACGGAAAGACGCACCGA
ACAGTCTTACTATGCTCCGGTAACACGCCGCCCGCAGTCCAGCCTCTGACAACAGCTGATACGTATAGCCAGGCT
GGTGGGGGATGGTGCGGCATGCAAACTACGTCGGGTCACTCCTGTATACCTGGGCCTCATGCGTGTCATGCGGCT
TCGATCACCTCTTACCGTACACTGAAGCAATCATCGTGA
Gene >Hirsu2|8521
ATGTATGAGCCAAGAGTCACAGGTCGGACCAAGGTCCTCCTCAACGAAGCTCTAAGTATGGCTCTTATCACAGGG
AGTCCCATTCTGCTTCTTTTCTATTGGATCACGTACAACTTCTTCGACGCCTCGCTCTCGGCAAGCGGAGCAGCT
CTGCTCCATGAAGGCGCAGCCACGTTCTTTTTGTCGCGCCTGCCATGGCCGACGATTTCTTCACTCAAGGGCTAC
GGGTTTTGGGTTGTTTCTCAAGCTCTGCTATATCATTTCCTGCCAGGTGCTCTCCATCTTGCACCCCGGACCCCT
GGCGGAAGACGGCTACTTTACAGATTGAACGGGCTTCTCGCCTGGTTCCTGACCGTTGCGGTTGCGGCTGCAGCC
TCTTACTTTGGGACTTTGGACCCTACAGTTATCGCAAAACAATGGGGAGAAGGCTTAGCGACCGCCAACGTTTAC
GCACTCACCTTGGTGGGCGTCTTCTATGTCAAGGCTCGCGTTAGACCAGACGAACCTGGAGACACGCTATTCACA
GGCGAGTGCCGTACACCGTACGCTGCTTCCCCCAAGCTCACAAAAAGATGCGGTAGGGCATTTCTGGTATGACCT
TTTCAACGGAGGCGAGCTTCACCCACGGACTGGCCGCATTTTCGACTGGAAGCACTTCAACTGCAGCCGAACAGG
GGGCATTCTCGTCTGGACTTTGATGTGCGTCTCAGGTCTCTTTACCGTTCACTGGACGAAGATGTTGACACGGGG
GGACGGAAGCGATCTATCGTTTGCTGCCCTTCAGCGTCAGCGTCATGGAAGCCTCACTGCCTCGATGATTCTCGC
ATGTGCCTTTCGCATGATCGTCGTGGGGGAGTATTTTTATCTCGAGCACTGGTGAGCAAGCCCTTGCCCTGTGGA
CCTTTTCTTCCTCTCTCAGAAAGCACGTCCGCAGGACTTTGACCGTGCAGATCAGGTTCTACGAAACGCTAGACG
GCGCCCACGAGCGGTTCTCCTTCTACAGCATCTACGGCTTTGCTGCCATGATGCCGCAGCTATGGACCCTACAGA
CGCAATACTTGGCGAAGCACCCAGTGGACCTGTCATACGGCGTCATTGCCGGCACTATCGCTTTGTTTGCTTTGG
GGTGGATGCTGAACCACGATGCAAACCGACAGAAGAGCCTGTCGAGGCAAACTGCCGGACGGTGCGTCATCTGGG
GAGCGCCCGCCCAGTTCCTCGAAGCGACCTATAAGACTGCCGACGGAAAGACGCACCGAACAGTCTTACTATGCT
CCGGTAACACGCCGCCCGCAGTCCAGCCTCTGACAACAGCTGATACGTATAGCCAGGCTGGTGGGGGATGGTGCG
GCATGCAAACTACGTCGGGTCACTCCTGTATACCTGGGCCTCATGCGTGTCATGCGGCTTCGATCACCTCTTACC
GTACACTGAAGCAATCATCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail