Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8503
Gene name
LocationContig_56:24233..27038
Strand-
Gene length (bp)2805
Transcript length (bp)2721
Coding sequence length (bp)2721
Protein length (aa) 907

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04253 TFR_dimer Transferrin receptor-like dimerisation domain 3.6E-33 775 900
PF04389 Peptidase_M28 Peptidase family M28 6.7E-20 524 709
PF02225 PA PA domain 2.6E-12 336 423

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 160 900 1.0E-92
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 222 874 1.0E-92
sp|O77564|FOLH1_PIG Glutamate carboxypeptidase 2 OS=Sus scrofa GN=FOLH1 PE=1 SV=1 166 900 2.0E-92
sp|Q04609|FOLH1_HUMAN Glutamate carboxypeptidase 2 OS=Homo sapiens GN=FOLH1 PE=1 SV=1 221 900 6.0E-92
sp|O35409|FOLH1_MOUSE Glutamate carboxypeptidase 2 OS=Mus musculus GN=Folh1 PE=1 SV=2 166 890 7.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 160 900 1.0E-92
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 222 874 1.0E-92
sp|O77564|FOLH1_PIG Glutamate carboxypeptidase 2 OS=Sus scrofa GN=FOLH1 PE=1 SV=1 166 900 2.0E-92
sp|Q04609|FOLH1_HUMAN Glutamate carboxypeptidase 2 OS=Homo sapiens GN=FOLH1 PE=1 SV=1 221 900 6.0E-92
sp|O35409|FOLH1_MOUSE Glutamate carboxypeptidase 2 OS=Mus musculus GN=Folh1 PE=1 SV=2 166 890 7.0E-91
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 222 890 8.0E-91
sp|D4B1R0|GCP1_ARTBC Probable glutamate carboxypeptidase ARB_02390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02390 PE=1 SV=1 228 900 8.0E-90
sp|Q9UQQ1|NALDL_HUMAN N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Homo sapiens GN=NAALADL1 PE=1 SV=2 221 900 2.0E-83
sp|O54697|NALDL_RAT N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Rattus norvegicus GN=Naaladl1 PE=1 SV=1 185 872 4.0E-83
sp|Q7M758|NALDL_MOUSE N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Mus musculus GN=Naaladl1 PE=2 SV=1 220 900 9.0E-81
sp|Q9M1S8|GCP2_ARATH Probable glutamate carboxypeptidase 2 OS=Arabidopsis thaliana GN=AMP1 PE=1 SV=3 224 892 5.0E-77
sp|Q5WN23|GCP2_CAEBR Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis briggsae GN=CBG08178 PE=3 SV=1 231 884 3.0E-74
sp|P91406|GCP2_CAEEL Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis elegans GN=R57.1 PE=1 SV=2 188 795 9.0E-74
sp|O43023|YGV9_SCHPO Inactive zinc metalloprotease C354.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.09c PE=3 SV=1 184 896 6.0E-73
sp|P47161|VPS70_YEAST Vacuolar protein sorting-associated protein 70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS70 PE=1 SV=1 187 754 5.0E-55
sp|Q9HBA9|FOH1B_HUMAN Putative N-acetylated-alpha-linked acidic dipeptidase OS=Homo sapiens GN=FOLH1B PE=2 SV=1 481 898 3.0E-53
sp|B2GUY2|TFR2_RAT Transferrin receptor protein 2 OS=Rattus norvegicus GN=Tfr2 PE=2 SV=1 223 855 1.0E-44
sp|Q08919|TRE1_YEAST Uncharacterized protein TRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE1 PE=1 SV=1 184 906 1.0E-44
sp|Q9JKX3|TFR2_MOUSE Transferrin receptor protein 2 OS=Mus musculus GN=Tfr2 PE=1 SV=2 223 855 2.0E-44
sp|Q9UP52|TFR2_HUMAN Transferrin receptor protein 2 OS=Homo sapiens GN=TFR2 PE=1 SV=1 178 855 4.0E-44
sp|Q2V905|TFR1_HORSE Transferrin receptor protein 1 OS=Equus caballus GN=TFRC PE=2 SV=1 223 855 5.0E-40
sp|Q08693|TRE2_YEAST Putative zinc metalloprotease TRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE2 PE=1 SV=1 170 900 6.0E-38
sp|Q9MYZ3|TFR1_FELCA Transferrin receptor protein 1 OS=Felis catus GN=TFRC PE=1 SV=1 223 768 4.0E-35
sp|Q9GLD3|TFR1_CANLF Transferrin receptor protein 1 OS=Canis lupus familiaris GN=TFRC PE=1 SV=1 251 768 1.0E-34
sp|Q8HZV3|TFR1_PIG Transferrin receptor protein 1 OS=Sus scrofa GN=TFRC PE=2 SV=1 251 761 3.0E-33
sp|Q07891|TFR1_CRIGR Transferrin receptor protein 1 OS=Cricetulus griseus GN=TFRC PE=2 SV=1 223 650 5.0E-33
sp|Q5RDH6|TFR1_PONAB Transferrin receptor protein 1 OS=Pongo abelii GN=TFRC PE=2 SV=1 222 855 8.0E-33
sp|P02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 222 855 7.0E-32
sp|Q99376|TFR1_RAT Transferrin receptor protein 1 (Fragment) OS=Rattus norvegicus GN=Tfrc PE=2 SV=1 251 855 7.0E-31
sp|Q90997|TFR1_CHICK Transferrin receptor protein 1 OS=Gallus gallus GN=TFRC PE=2 SV=2 232 652 8.0E-31
sp|Q62351|TFR1_MOUSE Transferrin receptor protein 1 OS=Mus musculus GN=Tfrc PE=1 SV=1 223 855 2.0E-30
sp|Q58DX5|NADL2_HUMAN Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 OS=Homo sapiens GN=NAALADL2 PE=1 SV=3 176 743 2.0E-28
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 187 209 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8503
MPSEKQPFYDPVPPTYDEALASSSRRDGTWPLPRSSTADETESQSLLPHAESSAGASRRPNGYRPPTVETDDEDS
LFGSDGDVDFDSDDDDEAAHVRREMQEMDVEEPSRSRGSVWGKRIGFRLSLPRWKWSWRPVLPHIRIQLPSLPAA
SEGSEDGAAAGDAETRRRRWELPRISNLTLLLAFARLVALVVILGFVYFLFATGVFGGLSSRLGAGMRFDPEDLR
QHLLHNVEPMRLRASVQHFSHYAHIAGTEGDYATAMDVESMFSRAGLDKIEVDEYYVYVNYPRRDGRAVQIMDGS
GDKAIWTAKLEEAEVGGETAGRQTYAFHGHSKSGDVKGPLIYANYGSRDDFKTLRDKGIHTEGAIALVRYYGTES
DRALKIKAAELAGFAGCIIYSDPADDGFRRGDVAPHGRWMPADGVQRGGVSMMSYVVGDVLTPGWESKKDLPRMK
VNETAGLVKIPSLPLAWRDAQVLLQHLRGHGQRVPDGWEGGVPDVGEWWTGNGTSPLVRLQNEQDEIEQQPIWNV
YGKIVGMEQTARSIILGNHRDAWAFGAVDPHTGTAVMIELARILGGLVKRGWRPLRTIEFMSWDAEEYNLVGSTE
FVENNLERLRQSAYAYINLDTVISGTELHAAGSPALERALLRALDRVVDPNANATLRHLWKPPGGRMGSLGAGSD
YVAFQDIAGTSSLDLEFRGDGFPFHSSYDNFALVDEVIDPGFVYHTLMTQVVGLLLLDLADRAVLPFGMATYADA
LKGWVRDLDEWVKGKGANRDERSSLSLAELGEAADAVKRNADKFEGWELEWNRLVLSSGGWEANDLGMRRMSYND
KMAAFETALLDLELGGGIPNRTQFKHVVYGPELWSSYDGAVFPAIRDTVEAGEWDLARRVTAKTAAILRQAAAVL
DMEDER*
Coding >Hirsu2|8503
ATGCCTTCCGAAAAACAGCCCTTCTACGACCCGGTGCCCCCGACGTACGATGAAGCGCTCGCGAGCAGCAGCCGG
CGCGACGGCACGTGGCCCCTCCCGAGGTCCTCGACCGCCGACGAGACCGAGTCACAATCCCTCCTCCCCCACGCA
GAGTCCTCGGCTGGCGCGTCGAGGCGGCCCAACGGCTACCGCCCGCCCACGGTAGAGACGGACGACGAGGATAGC
CTCTTTGGCAGCGATGGCGACGTCGATTTCGACAGCGACGACGACGACGAGGCCGCCCACGTGCGCCGCGAGATG
CAGGAGATGGACGTCGAGGAGCCCTCGCGGAGCCGGGGCTCCGTCTGGGGCAAGAGGATAGGATTCCGGCTCTCC
CTCCCGCGCTGGAAGTGGTCCTGGAGGCCCGTCCTGCCGCACATCAGGATCCAGCTCCCCTCGCTGCCCGCCGCG
TCCGAGGGCAGTGAAGACGGCGCCGCCGCCGGAGACGCCGAGACCCGCCGCCGCCGCTGGGAGCTGCCCAGGATC
AGCAACCTGACGCTGCTCCTGGCCTTCGCACGCCTCGTCGCTCTCGTCGTCATCCTCGGCTTCGTCTACTTCCTC
TTCGCCACCGGCGTCTTCGGCGGCCTGTCGTCCCGGCTCGGCGCCGGCATGCGTTTCGACCCCGAGGACCTCCGC
CAACACTTGTTGCACAACGTCGAGCCCATGCGGCTGCGCGCCTCGGTTCAACACTTCTCCCACTACGCTCACATC
GCTGGCACCGAGGGCGACTACGCCACGGCCATGGACGTCGAGAGCATGTTCAGCAGGGCCGGGCTTGACAAGATC
GAGGTCGACGAGTACTACGTCTACGTAAACTACCCGCGCAGAGACGGCCGGGCCGTGCAGATCATGGACGGCAGC
GGCGACAAGGCCATCTGGACGGCCAAGCTGGAGGAGGCCGAGGTCGGCGGCGAGACGGCGGGCCGGCAGACGTAC
GCCTTCCACGGCCACTCCAAGTCGGGCGACGTCAAGGGGCCCTTGATCTACGCAAACTACGGGTCGCGCGACGAC
TTCAAGACGCTGCGGGACAAGGGCATCCACACCGAGGGCGCCATCGCGCTGGTGCGCTACTACGGCACCGAGTCG
GACCGCGCCCTCAAGATCAAGGCGGCCGAGCTCGCCGGCTTCGCGGGCTGCATCATCTACAGCGACCCCGCCGAC
GACGGCTTCCGCCGCGGCGACGTGGCGCCCCACGGCCGCTGGATGCCGGCCGACGGCGTGCAGCGCGGCGGCGTC
AGCATGATGAGCTACGTCGTCGGCGACGTCCTGACGCCCGGGTGGGAGAGCAAGAAGGACCTGCCGCGGATGAAG
GTCAACGAGACGGCCGGCCTGGTCAAGATCCCGAGCCTGCCGCTGGCGTGGAGGGACGCCCAGGTGCTGCTGCAG
CACCTGCGCGGGCACGGCCAGCGGGTGCCGGACGGGTGGGAGGGCGGCGTGCCCGACGTCGGCGAGTGGTGGACG
GGCAACGGCACGTCGCCGCTCGTCCGGCTGCAGAACGAGCAGGACGAGATCGAGCAGCAGCCCATCTGGAACGTC
TACGGCAAGATCGTCGGGATGGAGCAGACGGCCCGGTCCATCATCCTCGGCAACCACCGGGACGCGTGGGCCTTC
GGCGCCGTCGACCCGCACACGGGGACGGCCGTCATGATCGAGCTGGCGCGCATCCTGGGCGGCCTCGTCAAGCGG
GGGTGGCGGCCGCTGCGGACCATCGAGTTCATGTCGTGGGACGCCGAGGAGTACAACCTGGTGGGCTCGACCGAG
TTCGTCGAGAACAACCTGGAGCGGCTGCGGCAGAGCGCGTACGCCTACATCAACCTCGACACCGTCATCTCCGGG
ACGGAGCTCCACGCGGCCGGCTCGCCCGCCCTCGAGCGGGCGCTCCTCCGGGCGCTCGACCGGGTCGTCGACCCC
AACGCCAACGCCACGCTCCGCCACCTGTGGAAGCCACCGGGGGGCCGGATGGGCAGCCTGGGCGCGGGCAGCGAC
TATGTCGCCTTCCAAGACATCGCGGGCACCAGCTCGCTCGACCTCGAGTTCCGGGGCGACGGCTTCCCCTTCCAC
TCGAGCTACGACAACTTCGCGCTGGTGGACGAGGTCATCGACCCGGGCTTCGTCTACCACACGCTCATGACGCAG
GTGGTGGGCCTGCTGCTCCTCGACCTGGCCGACCGCGCCGTCCTGCCGTTCGGCATGGCGACGTACGCCGACGCG
CTCAAGGGCTGGGTGCGCGACCTGGACGAGTGGGTCAAGGGCAAGGGCGCCAACAGAGACGAGCGGTCGAGCCTC
TCGCTCGCCGAGCTGGGCGAGGCCGCCGACGCCGTCAAGCGCAACGCGGACAAGTTCGAGGGCTGGGAGCTGGAG
TGGAACCGGCTGGTGCTGTCGAGCGGCGGGTGGGAGGCCAACGACCTGGGCATGCGGCGGATGAGCTACAACGAC
AAGATGGCGGCCTTTGAGACGGCCCTGCTGGACCTGGAGCTCGGGGGCGGTATACCCAACCGCACGCAGTTCAAG
CACGTCGTCTACGGCCCCGAGCTGTGGTCGAGCTACGACGGAGCCGTCTTCCCCGCGATCCGGGACACGGTCGAG
GCCGGCGAGTGGGATCTGGCGCGGCGCGTCACGGCCAAGACGGCGGCGATCCTGCGGCAGGCGGCGGCGGTGCTC
GACATGGAGGACGAGAGATGA
Transcript >Hirsu2|8503
ATGCCTTCCGAAAAACAGCCCTTCTACGACCCGGTGCCCCCGACGTACGATGAAGCGCTCGCGAGCAGCAGCCGG
CGCGACGGCACGTGGCCCCTCCCGAGGTCCTCGACCGCCGACGAGACCGAGTCACAATCCCTCCTCCCCCACGCA
GAGTCCTCGGCTGGCGCGTCGAGGCGGCCCAACGGCTACCGCCCGCCCACGGTAGAGACGGACGACGAGGATAGC
CTCTTTGGCAGCGATGGCGACGTCGATTTCGACAGCGACGACGACGACGAGGCCGCCCACGTGCGCCGCGAGATG
CAGGAGATGGACGTCGAGGAGCCCTCGCGGAGCCGGGGCTCCGTCTGGGGCAAGAGGATAGGATTCCGGCTCTCC
CTCCCGCGCTGGAAGTGGTCCTGGAGGCCCGTCCTGCCGCACATCAGGATCCAGCTCCCCTCGCTGCCCGCCGCG
TCCGAGGGCAGTGAAGACGGCGCCGCCGCCGGAGACGCCGAGACCCGCCGCCGCCGCTGGGAGCTGCCCAGGATC
AGCAACCTGACGCTGCTCCTGGCCTTCGCACGCCTCGTCGCTCTCGTCGTCATCCTCGGCTTCGTCTACTTCCTC
TTCGCCACCGGCGTCTTCGGCGGCCTGTCGTCCCGGCTCGGCGCCGGCATGCGTTTCGACCCCGAGGACCTCCGC
CAACACTTGTTGCACAACGTCGAGCCCATGCGGCTGCGCGCCTCGGTTCAACACTTCTCCCACTACGCTCACATC
GCTGGCACCGAGGGCGACTACGCCACGGCCATGGACGTCGAGAGCATGTTCAGCAGGGCCGGGCTTGACAAGATC
GAGGTCGACGAGTACTACGTCTACGTAAACTACCCGCGCAGAGACGGCCGGGCCGTGCAGATCATGGACGGCAGC
GGCGACAAGGCCATCTGGACGGCCAAGCTGGAGGAGGCCGAGGTCGGCGGCGAGACGGCGGGCCGGCAGACGTAC
GCCTTCCACGGCCACTCCAAGTCGGGCGACGTCAAGGGGCCCTTGATCTACGCAAACTACGGGTCGCGCGACGAC
TTCAAGACGCTGCGGGACAAGGGCATCCACACCGAGGGCGCCATCGCGCTGGTGCGCTACTACGGCACCGAGTCG
GACCGCGCCCTCAAGATCAAGGCGGCCGAGCTCGCCGGCTTCGCGGGCTGCATCATCTACAGCGACCCCGCCGAC
GACGGCTTCCGCCGCGGCGACGTGGCGCCCCACGGCCGCTGGATGCCGGCCGACGGCGTGCAGCGCGGCGGCGTC
AGCATGATGAGCTACGTCGTCGGCGACGTCCTGACGCCCGGGTGGGAGAGCAAGAAGGACCTGCCGCGGATGAAG
GTCAACGAGACGGCCGGCCTGGTCAAGATCCCGAGCCTGCCGCTGGCGTGGAGGGACGCCCAGGTGCTGCTGCAG
CACCTGCGCGGGCACGGCCAGCGGGTGCCGGACGGGTGGGAGGGCGGCGTGCCCGACGTCGGCGAGTGGTGGACG
GGCAACGGCACGTCGCCGCTCGTCCGGCTGCAGAACGAGCAGGACGAGATCGAGCAGCAGCCCATCTGGAACGTC
TACGGCAAGATCGTCGGGATGGAGCAGACGGCCCGGTCCATCATCCTCGGCAACCACCGGGACGCGTGGGCCTTC
GGCGCCGTCGACCCGCACACGGGGACGGCCGTCATGATCGAGCTGGCGCGCATCCTGGGCGGCCTCGTCAAGCGG
GGGTGGCGGCCGCTGCGGACCATCGAGTTCATGTCGTGGGACGCCGAGGAGTACAACCTGGTGGGCTCGACCGAG
TTCGTCGAGAACAACCTGGAGCGGCTGCGGCAGAGCGCGTACGCCTACATCAACCTCGACACCGTCATCTCCGGG
ACGGAGCTCCACGCGGCCGGCTCGCCCGCCCTCGAGCGGGCGCTCCTCCGGGCGCTCGACCGGGTCGTCGACCCC
AACGCCAACGCCACGCTCCGCCACCTGTGGAAGCCACCGGGGGGCCGGATGGGCAGCCTGGGCGCGGGCAGCGAC
TATGTCGCCTTCCAAGACATCGCGGGCACCAGCTCGCTCGACCTCGAGTTCCGGGGCGACGGCTTCCCCTTCCAC
TCGAGCTACGACAACTTCGCGCTGGTGGACGAGGTCATCGACCCGGGCTTCGTCTACCACACGCTCATGACGCAG
GTGGTGGGCCTGCTGCTCCTCGACCTGGCCGACCGCGCCGTCCTGCCGTTCGGCATGGCGACGTACGCCGACGCG
CTCAAGGGCTGGGTGCGCGACCTGGACGAGTGGGTCAAGGGCAAGGGCGCCAACAGAGACGAGCGGTCGAGCCTC
TCGCTCGCCGAGCTGGGCGAGGCCGCCGACGCCGTCAAGCGCAACGCGGACAAGTTCGAGGGCTGGGAGCTGGAG
TGGAACCGGCTGGTGCTGTCGAGCGGCGGGTGGGAGGCCAACGACCTGGGCATGCGGCGGATGAGCTACAACGAC
AAGATGGCGGCCTTTGAGACGGCCCTGCTGGACCTGGAGCTCGGGGGCGGTATACCCAACCGCACGCAGTTCAAG
CACGTCGTCTACGGCCCCGAGCTGTGGTCGAGCTACGACGGAGCCGTCTTCCCCGCGATCCGGGACACGGTCGAG
GCCGGCGAGTGGGATCTGGCGCGGCGCGTCACGGCCAAGACGGCGGCGATCCTGCGGCAGGCGGCGGCGGTGCTC
GACATGGAGGACGAGAGATGA
Gene >Hirsu2|8503
ATGCCTTCCGAAAAACAGCCCTTCTACGACCCGGTGCCCCCGACGTACGATGAAGCGCTCGCGAGCAGCAGCCGG
CGCGACGGCACGTGGCCCCTCCCGAGGTCCTCGACCGCCGACGAGACCGAGTCACAATCCCTCCTCCCCCACGCA
GAGTCCTCGGCTGGCGCGTCGAGGCGGCCCAACGGCTACCGCCCGCCCACGGTAGAGACGGACGACGAGGATAGC
CTCTTTGGCAGCGATGGCGACGTCGATTTCGACAGCGACGACGACGACGAGGCCGCCCACGTGCGCCGCGAGATG
CAGGAGATGGACGTCGAGGAGCCCTCGCGGAGCCGGGGCTCCGTCTGGGGCAAGAGGATAGGATTCCGGCTCTCC
CTCCCGCGCTGGAAGTGGTCCTGGAGGCCCGTCCTGCCGCACATCAGGATCCAGCTCCCCTCGCTGCCCGCCGCG
TCCGAGGGCAGTGAAGACGGCGCCGCCGCCGGAGACGCCGAGACCCGCCGCCGCCGCTGGGAGCTGCCCAGGATC
AGCAACCTGACGCTGCTCCTGGCCTTCGCACGCCTCGTCGCTCTCGTCGTCATCCTCGGCTTCGTCTACTTCCTC
TTCGCCACCGGCGTCTTCGGCGGCCTGTCGTCCCGGCTCGGCGCCGGCATGCGTTTCGACCCCGAGGACCTCCGC
CAACACTTGTTGCACAACGTCGAGCCCATGCGGCTGCGCGCCTCGGTTCAACACTTCTCCCACTACGCTCACATC
GCTGGCACCGAGGGCGACTACGCCACGGCCATGGACGTCGAGAGCATGTTCAGCAGGGCCGGGCTTGACAAGATC
GAGGTCGACGAGTACTACGTCTACGTAAACTACCCGCGCAGAGACGGCCGGGCCGTGCAGATCATGGACGGCAGC
GGCGACAAGGCCATCTGGACGGCCAAGCTGGAGGAGGCCGAGGTCGGCGGCGAGACGGCGGGCCGGCAGACGTAC
GCCTTCCACGGCCACTCCAAGTCGGGCGACGTCAAGGGGCCCTTGATCTACGCAAACTACGGGTCGCGCGACGAC
TTCAAGACGCTGCGGGACAAGGGCATCCACACCGAGGGCGCCATCGCGCTGGTGCGCTACTACGGCACCGAGTCG
GACCGCGCCCTCAAGATCAAGGCGGCCGAGCTCGCCGGCTTCGCGGGCTGCATCATCTACAGCGACCCCGCCGAC
GACGGCTTCCGCCGCGGCGACGTGGCGCCCCACGGCCGCTGGATGCCGGCCGACGGCGTGCAGCGCGGCGGCGTC
AGCATGATGAGCTACGTCGTCGGCGACGTCCTGACGCCCGGGTGGGAGAGCAAGAAGGACCTGCCGCGGATGAAG
GTCAACGAGACGGCCGGCCTGGTCAAGATCCCGAGCCTGCCGCTGGCGTGGAGGGACGCCCAGGTGCTGCTGCAG
CACCTGCGCGGGCACGGCCAGCGGGTGCCGGACGGGTGGGAGGGCGGCGTGCCCGACGTCGGCGAGTGGTGGACG
GGCAACGGCACGTCGCCGCTCGTCCGGCTGCAGAACGAGCAGGACGAGATCGAGCAGCAGCCCATCTGGAACGTC
TACGGCAAGATCGTCGGGATGGAGCAGACGGCCCGGTCCATCATCCTCGGCAACCACCGGGACGCGTGGGCCTTC
GGCGCCGTCGACCCGCACACGGGGACGGCCGTCATGATCGAGCTGGCGCGCATCCTGGGCGGCCTCGTCAAGCGG
GGGTGGCGGCCGCTGCGGACCATCGAGTTCATGTCGTGGGACGCCGAGGAGTACAACCTGGTGGGCTCGACCGAG
TTCGTCGAGAACAACCTGGAGCGGCTGCGGCAGAGCGCGTACGCCTACATCAACCTCGACACCGTCATCTCCGGG
ACGGAGCTCCACGCGGCCGGCTCGCCCGCCCTCGAGCGGGCGCTCCTCCGGGCGCTCGACCGGGTCGTCGACCCC
AACGCCAACGCCACGCTCCGCCACCTGTGGAAGCCACCGGGGGGCCGGATGGGCAGCCTGGGCGCGGGCAGCGAC
TATGTCGCCTTCCAAGACATCGCGGGCACCAGCTCGCTCGACCTCGAGTTCCGGGGCGACGGCTTCCCCTTCCAC
TCGAGCTACGACAACTTCGCGCTGGTGGACGAGGTCATCGACCCGGGCTTCGTCTACCACACGCTCATGACGCAG
GTGGTGGGCCTGCTGCTCCTCGACCTGGCCGACCGCGCCGTCCTGCCGTTCGGCATGGCGACGTACGCCGACGCG
CTCAAGGGCTGGGTGCGCGACCTGGACGAGTGGGTCAAGGGCAAGGGCGCCAACAGAGACGAGCGGTCGAGCCTC
TCGCTCGCCGAGCTGGGCGAGGCCGCCGACGCCGTCAAGCGCAACGCGGACAAGTTCGAGGGCTGGGAGCTGGAG
TGGAACCGGCTGGTGCTGTCGAGCGGCGGGTGGGAGGCCAACGACCTGGGCATGCGGCGGATGAGCTACAACGAC
AAGATGGCGGCCTTTGAGACGGCCCTGCTGGACCTGGAGCTCGGGGGCGGTGTAAGTCTTGTTCCCGTTCCGTTC
CTCCCGTCTCTCTGCTCGGGCGGATCGGACCAGCACTGACAGGCGGCCGCCGGGATGCAGATACCCAACCGCACG
CAGTTCAAGCACGTCGTCTACGGCCCCGAGCTGTGGTCGAGCTACGACGGAGCCGTCTTCCCCGCGATCCGGGAC
ACGGTCGAGGCCGGCGAGTGGGATCTGGCGCGGCGCGTCACGGCCAAGACGGCGGCGATCCTGCGGCAGGCGGCG
GCGGTGCTCGACATGGAGGACGAGAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail