Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8499
Gene name
LocationContig_56:16425..17007
Strand-
Gene length (bp)582
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00411 Ribosomal_S11 Ribosomal protein S11 2.7E-09 78 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13882|RT18_SCHPO Putative 37S ribosomal protein S18, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrps18 PE=3 SV=1 64 182 4.0E-28
sp|P42847|RT18_YEAST 37S ribosomal protein S18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS18 PE=1 SV=2 68 193 2.0E-19
sp|A6LLN9|RS11_THEM4 30S ribosomal protein S11 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsK PE=3 SV=1 63 191 1.0E-10
sp|B2XTU1|RR11_HETA4 30S ribosomal protein S11, chloroplastic OS=Heterosigma akashiwo (strain CCMP452) GN=rps11 PE=3 SV=1 79 193 2.0E-10
sp|B2XTD5|RR11_HETA2 30S ribosomal protein S11, chloroplastic OS=Heterosigma akashiwo (strain NIES-293) GN=rps11 PE=3 SV=1 79 193 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13882|RT18_SCHPO Putative 37S ribosomal protein S18, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrps18 PE=3 SV=1 64 182 4.0E-28
sp|P42847|RT18_YEAST 37S ribosomal protein S18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS18 PE=1 SV=2 68 193 2.0E-19
sp|A6LLN9|RS11_THEM4 30S ribosomal protein S11 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsK PE=3 SV=1 63 191 1.0E-10
sp|B2XTU1|RR11_HETA4 30S ribosomal protein S11, chloroplastic OS=Heterosigma akashiwo (strain CCMP452) GN=rps11 PE=3 SV=1 79 193 2.0E-10
sp|B2XTD5|RR11_HETA2 30S ribosomal protein S11, chloroplastic OS=Heterosigma akashiwo (strain NIES-293) GN=rps11 PE=3 SV=1 79 193 2.0E-10
sp|B1LBL4|RS11_THESQ 30S ribosomal protein S11 OS=Thermotoga sp. (strain RQ2) GN=rpsK PE=3 SV=1 78 193 3.0E-10
sp|A5IMA9|RS11_THEP1 30S ribosomal protein S11 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsK PE=3 SV=1 78 193 3.0E-10
sp|A7HM26|RS11_FERNB 30S ribosomal protein S11 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsK PE=3 SV=1 67 193 3.0E-10
sp|Q9X1I4|RS11_THEMA 30S ribosomal protein S11 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsK PE=3 SV=1 78 193 3.0E-10
sp|A9B435|RS11_HERA2 30S ribosomal protein S11 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpsK PE=3 SV=1 77 193 3.0E-10
sp|B7IHX1|RS11_THEAB 30S ribosomal protein S11 OS=Thermosipho africanus (strain TCF52B) GN=rpsK PE=3 SV=1 63 191 4.0E-10
sp|B9K8B2|RS11_THENN 30S ribosomal protein S11 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsK PE=3 SV=1 78 193 4.0E-10
sp|A2SLD3|RS11_METPP 30S ribosomal protein S11 OS=Methylibium petroleiphilum (strain PM1) GN=rpsK PE=3 SV=1 79 193 5.0E-10
sp|A9BFZ2|RS11_PETMO 30S ribosomal protein S11 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsK PE=3 SV=1 78 191 1.0E-09
sp|Q1LTB5|RS11_BAUCH 30S ribosomal protein S11 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsK PE=3 SV=1 79 193 2.0E-09
sp|A1S241|RS11_SHEAM 30S ribosomal protein S11 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsK PE=3 SV=1 79 193 5.0E-09
sp|Q38UT6|RS11_LACSS 30S ribosomal protein S11 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsK PE=3 SV=1 79 193 6.0E-09
sp|C4K795|RS11_HAMD5 30S ribosomal protein S11 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsK PE=3 SV=1 79 193 6.0E-09
sp|B1YGX6|RS11_EXIS2 30S ribosomal protein S11 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsK PE=3 SV=1 78 193 7.0E-09
sp|B2VK73|RS11_ERWT9 30S ribosomal protein S11 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsK PE=3 SV=1 79 193 7.0E-09
sp|Q12ST6|RS11_SHEDO 30S ribosomal protein S11 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsK PE=3 SV=1 79 193 7.0E-09
sp|Q7MPG6|RS11_VIBVY 30S ribosomal protein S11 OS=Vibrio vulnificus (strain YJ016) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|P66369|RS11_VIBVU 30S ribosomal protein S11 OS=Vibrio vulnificus (strain CMCP6) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|P66368|RS11_VIBPA 30S ribosomal protein S11 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|C3LRN5|RS11_VIBCM 30S ribosomal protein S11 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|P66367|RS11_VIBCH 30S ribosomal protein S11 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|A7N0H6|RS11_VIBCB 30S ribosomal protein S11 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|A5F574|RS11_VIBC3 30S ribosomal protein S11 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|P0A0X2|RS11_XANCP 30S ribosomal protein S11 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|B0RU60|RS11_XANCB 30S ribosomal protein S11 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|Q4URG1|RS11_XANC8 30S ribosomal protein S11 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|Q3BWW1|RS11_XANC5 30S ribosomal protein S11 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|P0A0X3|RS11_XANAC 30S ribosomal protein S11 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsK PE=3 SV=1 79 193 9.0E-09
sp|A8F4T7|RS11_PSELT 30S ribosomal protein S11 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsK PE=3 SV=1 67 193 1.0E-08
sp|B2SQT2|RS11_XANOP 30S ribosomal protein S11 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|Q2P007|RS11_XANOM 30S ribosomal protein S11 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|Q15X50|RS11_PSEA6 30S ribosomal protein S11 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|Q5QXV6|RS11_IDILO 30S ribosomal protein S11 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|Q2NQP5|RS11_SODGM 30S ribosomal protein S11 OS=Sodalis glossinidius (strain morsitans) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|A8GKH5|RS11_SERP5 30S ribosomal protein S11 OS=Serratia proteamaculans (strain 568) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|A0L5Z6|RS11_MAGMM 30S ribosomal protein S11 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|B3R7E5|RS11_CUPTR 30S ribosomal protein S11 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|Q46WG7|RS11_CUPPJ 30S ribosomal protein S11 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|Q0K643|RS11_CUPNH 30S ribosomal protein S11 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|A1RED7|RS11_SHESW 30S ribosomal protein S11 OS=Shewanella sp. (strain W3-18-1) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|Q0I082|RS11_SHESR 30S ribosomal protein S11 OS=Shewanella sp. (strain MR-7) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|Q0HNR4|RS11_SHESM 30S ribosomal protein S11 OS=Shewanella sp. (strain MR-4) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|A0KRP7|RS11_SHESA 30S ribosomal protein S11 OS=Shewanella sp. (strain ANA-3) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|A4YBW0|RS11_SHEPC 30S ribosomal protein S11 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|P59375|RS11_SHEON 30S ribosomal protein S11 OS=Shewanella oneidensis (strain MR-1) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|A9KWC4|RS11_SHEB9 30S ribosomal protein S11 OS=Shewanella baltica (strain OS195) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|A6WHV1|RS11_SHEB8 30S ribosomal protein S11 OS=Shewanella baltica (strain OS185) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|A3DA49|RS11_SHEB5 30S ribosomal protein S11 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|B8EBI2|RS11_SHEB2 30S ribosomal protein S11 OS=Shewanella baltica (strain OS223) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|A3Q9A5|RS11_SHELP 30S ribosomal protein S11 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|B2FQK6|RS11_STRMK 30S ribosomal protein S11 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|B4SLH3|RS11_STRM5 30S ribosomal protein S11 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|Q7VKF6|RS11_HAEDU 30S ribosomal protein S11 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|B0BSV4|RS11_ACTPJ 30S ribosomal protein S11 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|B3GZ34|RS11_ACTP7 30S ribosomal protein S11 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|A3N380|RS11_ACTP2 30S ribosomal protein S11 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|Q8Z1X5|RS11_SALTI 30S ribosomal protein S11 OS=Salmonella typhi GN=rpsK PE=3 SV=1 79 193 1.0E-08
sp|B8CNF6|RS11_SHEPW 30S ribosomal protein S11 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A8GYZ8|RS11_SHEPA 30S ribosomal protein S11 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B0TLZ0|RS11_SHEHH 30S ribosomal protein S11 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A1JS03|RS11_YERE8 30S ribosomal protein S11 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B7VLD4|RS11_VIBTL 30S ribosomal protein S11 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A4JAR4|RS11_BURVG 30S ribosomal protein S11 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|Q2SU51|RS11_BURTA 30S ribosomal protein S11 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|Q63Q35|RS11_BURPS 30S ribosomal protein S11 OS=Burkholderia pseudomallei (strain K96243) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|A3NEF5|RS11_BURP6 30S ribosomal protein S11 OS=Burkholderia pseudomallei (strain 668) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|Q3JMT7|RS11_BURP1 30S ribosomal protein S11 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|A3P089|RS11_BURP0 30S ribosomal protein S11 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|A1V879|RS11_BURMS 30S ribosomal protein S11 OS=Burkholderia mallei (strain SAVP1) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|Q62GM9|RS11_BURMA 30S ribosomal protein S11 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|A2S7K0|RS11_BURM9 30S ribosomal protein S11 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|A3MRX8|RS11_BURM7 30S ribosomal protein S11 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|A9ADL7|RS11_BURM1 30S ribosomal protein S11 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|Q39KE3|RS11_BURL3 30S ribosomal protein S11 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|Q0BJ22|RS11_BURCM 30S ribosomal protein S11 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|B4E5E4|RS11_BURCJ 30S ribosomal protein S11 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|A0K3P9|RS11_BURCH 30S ribosomal protein S11 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|B1JU46|RS11_BURCC 30S ribosomal protein S11 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|Q1BRX2|RS11_BURCA 30S ribosomal protein S11 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|B1YRQ3|RS11_BURA4 30S ribosomal protein S11 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|O54296|RS11_SALTY 30S ribosomal protein S11 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsK PE=3 SV=2 79 193 2.0E-08
sp|B4TXC0|RS11_SALSV 30S ribosomal protein S11 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|C0PZW0|RS11_SALPC 30S ribosomal protein S11 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A9N8C1|RS11_SALPB 30S ribosomal protein S11 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q5PK08|RS11_SALPA 30S ribosomal protein S11 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B4SUR8|RS11_SALNS 30S ribosomal protein S11 OS=Salmonella newport (strain SL254) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B4TJY7|RS11_SALHS 30S ribosomal protein S11 OS=Salmonella heidelberg (strain SL476) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B5RH38|RS11_SALG2 30S ribosomal protein S11 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B5FJJ2|RS11_SALDC 30S ribosomal protein S11 OS=Salmonella dublin (strain CT_02021853) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q57J54|RS11_SALCH 30S ribosomal protein S11 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B5F7S3|RS11_SALA4 30S ribosomal protein S11 OS=Salmonella agona (strain SL483) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q65QX8|RS11_MANSM 30S ribosomal protein S11 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q3YWW2|RS11_SHISS 30S ribosomal protein S11 OS=Shigella sonnei (strain Ss046) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|P0A7S2|RS11_SHIFL 30S ribosomal protein S11 OS=Shigella flexneri GN=rpsK PE=3 SV=2 79 193 2.0E-08
sp|Q0T005|RS11_SHIF8 30S ribosomal protein S11 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q32B54|RS11_SHIDS 30S ribosomal protein S11 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q31VX9|RS11_SHIBS 30S ribosomal protein S11 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B2U2R6|RS11_SHIB3 30S ribosomal protein S11 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A9MN70|RS11_SALAR 30S ribosomal protein S11 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B7LRR4|RS11_ESCF3 30S ribosomal protein S11 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q1R635|RS11_ECOUT 30S ribosomal protein S11 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B1LHB1|RS11_ECOSM 30S ribosomal protein S11 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B6I211|RS11_ECOSE 30S ribosomal protein S11 OS=Escherichia coli (strain SE11) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B7NDR9|RS11_ECOLU 30S ribosomal protein S11 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|P0A7R9|RS11_ECOLI 30S ribosomal protein S11 OS=Escherichia coli (strain K12) GN=rpsK PE=1 SV=2 79 193 2.0E-08
sp|B1IQ02|RS11_ECOLC 30S ribosomal protein S11 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|P0A7S0|RS11_ECOL6 30S ribosomal protein S11 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsK PE=3 SV=2 79 193 2.0E-08
sp|Q0TCG4|RS11_ECOL5 30S ribosomal protein S11 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A1AGI8|RS11_ECOK1 30S ribosomal protein S11 OS=Escherichia coli O1:K1 / APEC GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A8A5A2|RS11_ECOHS 30S ribosomal protein S11 OS=Escherichia coli O9:H4 (strain HS) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B1X6E9|RS11_ECODH 30S ribosomal protein S11 OS=Escherichia coli (strain K12 / DH10B) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|C4ZUF2|RS11_ECOBW 30S ribosomal protein S11 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B7M103|RS11_ECO8A 30S ribosomal protein S11 OS=Escherichia coli O8 (strain IAI1) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B7N182|RS11_ECO81 30S ribosomal protein S11 OS=Escherichia coli O81 (strain ED1a) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B7NLL7|RS11_ECO7I 30S ribosomal protein S11 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B5YT16|RS11_ECO5E 30S ribosomal protein S11 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|P0A7S1|RS11_ECO57 30S ribosomal protein S11 OS=Escherichia coli O157:H7 GN=rpsK PE=3 SV=2 79 193 2.0E-08
sp|B7LHZ9|RS11_ECO55 30S ribosomal protein S11 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B7MCR3|RS11_ECO45 30S ribosomal protein S11 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B7UK21|RS11_ECO27 30S ribosomal protein S11 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A7ZSI6|RS11_ECO24 30S ribosomal protein S11 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A5V5X6|RS11_SPHWW 30S ribosomal protein S11 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|B8F6P8|RS11_HAEPS 30S ribosomal protein S11 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A6VLL1|RS11_ACTSZ 30S ribosomal protein S11 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q1LI61|RS11_CUPMC 30S ribosomal protein S11 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q089N1|RS11_SHEFN 30S ribosomal protein S11 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|A0T0Z3|RR11_THAPS 30S ribosomal protein S11, chloroplastic OS=Thalassiosira pseudonana GN=rps11 PE=3 SV=1 63 193 2.0E-08
sp|Q3ZZP8|RS11_DEHMC 30S ribosomal protein S11 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsK PE=3 SV=1 61 193 2.0E-08
sp|A5FRX0|RS11_DEHMB 30S ribosomal protein S11 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsK PE=3 SV=1 61 193 2.0E-08
sp|B4RT51|RS11_ALTMD 30S ribosomal protein S11 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q1GVN5|RS11_SPHAL 30S ribosomal protein S11 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q7NQH5|RS11_CHRVO 30S ribosomal protein S11 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsK PE=3 SV=1 78 193 2.0E-08
sp|B1KMW0|RS11_SHEWM 30S ribosomal protein S11 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsK PE=3 SV=1 79 193 2.0E-08
sp|Q9S0R0|RS11_SHEVD 30S ribosomal protein S11 OS=Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) GN=rpsK PE=3 SV=2 79 193 2.0E-08
sp|A9BRX3|RS11_DELAS 30S ribosomal protein S11 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q5NQ41|RS11_ZYMMO 30S ribosomal protein S11 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q13TJ4|RS11_BURXL 30S ribosomal protein S11 OS=Burkholderia xenovorans (strain LB400) GN=rpsK PE=3 SV=1 78 193 3.0E-08
sp|Q9HWF8|RS11_PSEAE 30S ribosomal protein S11 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q02T57|RS11_PSEAB 30S ribosomal protein S11 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|B7V666|RS11_PSEA8 30S ribosomal protein S11 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|A6UZL1|RS11_PSEA7 30S ribosomal protein S11 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|C1DKN6|RS11_AZOVD 30S ribosomal protein S11 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|A8G1C7|RS11_SHESH 30S ribosomal protein S11 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q9CL52|RS11_PASMU 30S ribosomal protein S11 OS=Pasteurella multocida (strain Pm70) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|B0UX37|RS11_HISS2 30S ribosomal protein S11 OS=Histophilus somni (strain 2336) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q2RQY3|RS11_RHORT 30S ribosomal protein S11 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|A4VHQ3|RS11_PSEU5 30S ribosomal protein S11 OS=Pseudomonas stutzeri (strain A1501) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|B1XSS5|RS11_POLNS 30S ribosomal protein S11 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|A5WCL2|RS11_PSYWF 30S ribosomal protein S11 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|B0V6U5|RS11_ACIBY 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain AYE) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|A3M961|RS11_ACIBT 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsK PE=3 SV=2 79 193 3.0E-08
sp|B0VQU1|RS11_ACIBS 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain SDF) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|B2HZ85|RS11_ACIBC 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain ACICU) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|B7IA16|RS11_ACIB5 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain AB0057) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|B7GW25|RS11_ACIB3 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q6F7T5|RS11_ACIAD 30S ribosomal protein S11 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q0I139|RS11_HAES1 30S ribosomal protein S11 OS=Haemophilus somnus (strain 129Pt) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|A5UDS4|RS11_HAEIE 30S ribosomal protein S11 OS=Haemophilus influenzae (strain PittEE) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q4QM99|RS11_HAEI8 30S ribosomal protein S11 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|C5CQ77|RS11_VARPS 30S ribosomal protein S11 OS=Variovorax paradoxus (strain S110) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|B3PK60|RS11_CELJU 30S ribosomal protein S11 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|P48136|RR11_CYAPA Cyanelle 30S ribosomal protein S11 OS=Cyanophora paradoxa GN=rps11 PE=3 SV=1 79 193 3.0E-08
sp|Q4ZMR6|RS11_PSEU2 30S ribosomal protein S11 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q889U8|RS11_PSESM 30S ribosomal protein S11 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q3K610|RS11_PSEPF 30S ribosomal protein S11 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|C3K2V3|RS11_PSEFS 30S ribosomal protein S11 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q48D59|RS11_PSE14 30S ribosomal protein S11 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q3IJK7|RS11_PSEHT 30S ribosomal protein S11 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|Q0VSI0|RS11_ALCBS 30S ribosomal protein S11 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsK PE=3 SV=1 79 193 3.0E-08
sp|P44379|RS11_HAEIN 30S ribosomal protein S11 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsK PE=3 SV=2 79 193 3.0E-08
sp|A1WK94|RS11_VEREI 30S ribosomal protein S11 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsK PE=3 SV=1 79 193 4.0E-08
sp|Q4K555|RS11_PSEF5 30S ribosomal protein S11 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsK PE=3 SV=1 79 193 4.0E-08
sp|A4WFA5|RS11_ENT38 30S ribosomal protein S11 OS=Enterobacter sp. (strain 638) GN=rpsK PE=3 SV=1 79 193 4.0E-08
sp|P59484|RS11_BUCBP 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsK PE=3 SV=1 79 193 4.0E-08
sp|A4SUY4|RS11_POLSQ 30S ribosomal protein S11 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpsK PE=3 SV=1 79 193 4.0E-08
sp|Q2W2L2|RS11_MAGSA 30S ribosomal protein S11 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsK PE=3 SV=1 79 193 4.0E-08
sp|B8GV35|RS11_THISH 30S ribosomal protein S11 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rpsK PE=3 SV=1 79 193 4.0E-08
sp|Q39XY1|RS11_GEOMG 30S ribosomal protein S11 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsK PE=3 SV=1 79 193 4.0E-08
sp|B9E9L6|RS11_MACCJ 30S ribosomal protein S11 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsK PE=3 SV=1 79 193 4.0E-08
sp|A4XZ67|RS11_PSEMY 30S ribosomal protein S11 OS=Pseudomonas mendocina (strain ymp) GN=rpsK PE=3 SV=1 79 193 5.0E-08
sp|Q18CI7|RS11_PEPD6 30S ribosomal protein S11 OS=Peptoclostridium difficile (strain 630) GN=rpsK PE=3 SV=1 77 193 5.0E-08
sp|Q3SLM6|RS11_THIDA 30S ribosomal protein S11 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsK PE=3 SV=1 79 193 5.0E-08
sp|A9IHR9|RS11_BORPD 30S ribosomal protein S11 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|B4F1K7|RS11_PROMH 30S ribosomal protein S11 OS=Proteus mirabilis (strain HI4320) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q7MYH3|RS11_PHOLL 30S ribosomal protein S11 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|C6DFS5|RS11_PECCP 30S ribosomal protein S11 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q6CZZ3|RS11_PECAS 30S ribosomal protein S11 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|A6TEV0|RS11_KLEP7 30S ribosomal protein S11 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q12G79|RS11_POLSJ 30S ribosomal protein S11 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|A1VJ38|RS11_POLNA 30S ribosomal protein S11 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q2N9D6|RS11_ERYLH 30S ribosomal protein S11 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q21M35|RS11_SACD2 30S ribosomal protein S11 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|B5FGD9|RS11_VIBFM 30S ribosomal protein S11 OS=Vibrio fischeri (strain MJ11) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q5E891|RS11_VIBF1 30S ribosomal protein S11 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|B6EPU7|RS11_ALISL 30S ribosomal protein S11 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|B1JJG8|RS11_YERPY 30S ribosomal protein S11 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q664U4|RS11_YERPS 30S ribosomal protein S11 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|A4TH13|RS11_YERPP 30S ribosomal protein S11 OS=Yersinia pestis (strain Pestoides F) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q1CCW6|RS11_YERPN 30S ribosomal protein S11 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|A9R916|RS11_YERPG 30S ribosomal protein S11 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q8ZJ89|RS11_YERPE 30S ribosomal protein S11 OS=Yersinia pestis GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|B2K514|RS11_YERPB 30S ribosomal protein S11 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q1C2W9|RS11_YERPA 30S ribosomal protein S11 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|A7FNL2|RS11_YERP3 30S ribosomal protein S11 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsK PE=3 SV=1 79 193 6.0E-08
sp|Q3Z955|RS11_DEHM1 30S ribosomal protein S11 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsK PE=3 SV=1 61 193 6.0E-08
sp|B0C431|RS11_ACAM1 30S ribosomal protein S11 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|Q21QP7|RS11_RHOFT 30S ribosomal protein S11 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|B8D826|RS11_BUCAT 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|P57568|RS11_BUCAI 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|B8D9S4|RS11_BUCA5 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|Q1QDG3|RS11_PSYCK 30S ribosomal protein S11 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|Q4FUD3|RS11_PSYA2 30S ribosomal protein S11 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|Q28US9|RS11_JANSC 30S ribosomal protein S11 OS=Jannaschia sp. (strain CCS1) GN=rpsK PE=3 SV=1 63 193 7.0E-08
sp|A1W331|RS11_ACISJ 30S ribosomal protein S11 OS=Acidovorax sp. (strain JS42) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|B9MBW0|RS11_ACIET 30S ribosomal protein S11 OS=Acidovorax ebreus (strain TPSY) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|A1TJU0|RS11_ACIAC 30S ribosomal protein S11 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|Q0ABF2|RS11_ALKEH 30S ribosomal protein S11 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsK PE=3 SV=1 79 193 7.0E-08
sp|A6W369|RS11_MARMS 30S ribosomal protein S11 OS=Marinomonas sp. (strain MWYL1) GN=rpsK PE=3 SV=1 79 193 8.0E-08
sp|Q8K972|RS11_BUCAP 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsK PE=3 SV=1 79 193 8.0E-08
sp|B1JAI9|RS11_PSEPW 30S ribosomal protein S11 OS=Pseudomonas putida (strain W619) GN=rpsK PE=3 SV=1 79 193 8.0E-08
sp|P59374|RS11_PSEPK 30S ribosomal protein S11 OS=Pseudomonas putida (strain KT2440) GN=rpsK PE=3 SV=1 79 193 8.0E-08
sp|A5VXS0|RS11_PSEP1 30S ribosomal protein S11 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsK PE=3 SV=1 79 193 8.0E-08
sp|Q1IFU3|RS11_PSEE4 30S ribosomal protein S11 OS=Pseudomonas entomophila (strain L48) GN=rpsK PE=3 SV=1 79 193 8.0E-08
sp|C5BQ84|RS11_TERTT 30S ribosomal protein S11 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsK PE=3 SV=1 79 193 8.0E-08
sp|B0KK89|RS11_PSEPG 30S ribosomal protein S11 OS=Pseudomonas putida (strain GB-1) GN=rpsK PE=3 SV=1 79 193 9.0E-08
sp|Q7VTA7|RS11_BORPE 30S ribosomal protein S11 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsK PE=3 SV=1 79 193 9.0E-08
sp|Q7W2D1|RS11_BORPA 30S ribosomal protein S11 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsK PE=3 SV=1 79 193 9.0E-08
sp|Q7WR99|RS11_BORBR 30S ribosomal protein S11 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsK PE=3 SV=1 79 193 9.0E-08
sp|Q2L245|RS11_BORA1 30S ribosomal protein S11 OS=Bordetella avium (strain 197N) GN=rpsK PE=3 SV=1 79 193 9.0E-08
sp|A1WV99|RS11_HALHL 30S ribosomal protein S11 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|B3WAJ3|RS11_LACCB 30S ribosomal protein S11 OS=Lactobacillus casei (strain BL23) GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|Q035A8|RS11_LACC3 30S ribosomal protein S11 OS=Lactobacillus casei (strain ATCC 334) GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|Q057C7|RS11_BUCCC 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|Q493I6|RS11_BLOPB 30S ribosomal protein S11 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|B0T2E5|RS11_CAUSK 30S ribosomal protein S11 OS=Caulobacter sp. (strain K31) GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|Q6LV93|RS11_PHOPR 30S ribosomal protein S11 OS=Photobacterium profundum GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|A4XLQ4|RS11_CALS8 30S ribosomal protein S11 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|B9MKF5|RS11_CALBD 30S ribosomal protein S11 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|C4L7V3|RS11_TOLAT 30S ribosomal protein S11 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|Q7VQC5|RS11_BLOFL 30S ribosomal protein S11 OS=Blochmannia floridanus GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|Q134V2|RS11_RHOPS 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsK PE=3 SV=1 79 193 1.0E-07
sp|Q9A8T0|RS11_CAUCR 30S ribosomal protein S11 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsK PE=3 SV=1 79 193 2.0E-07
sp|B8H4F7|RS11_CAUCN 30S ribosomal protein S11 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsK PE=3 SV=1 79 193 2.0E-07
sp|A4SSY3|RS11_AERS4 30S ribosomal protein S11 OS=Aeromonas salmonicida (strain A449) GN=rpsK PE=3 SV=1 79 193 2.0E-07
sp|A0KF43|RS11_AERHH 30S ribosomal protein S11 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsK PE=3 SV=1 79 193 2.0E-07
sp|A4YSL5|RS11_BRASO 30S ribosomal protein S11 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsK PE=3 SV=1 79 193 2.0E-07
sp|Q6EW19|RR11_NYMAL 30S ribosomal protein S11, chloroplastic OS=Nymphaea alba GN=rps11 PE=3 SV=1 78 193 2.0E-07
sp|B1Y8B3|RS11_LEPCP 30S ribosomal protein S11 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsK PE=3 SV=1 79 193 2.0E-07
sp|Q1GK05|RS11_RUEST 30S ribosomal protein S11 OS=Ruegeria sp. (strain TM1040) GN=rpsK PE=3 SV=1 79 193 2.0E-07
sp|B3QBV6|RS11_RHOPT 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsK PE=3 SV=1 79 193 2.0E-07
sp|Q6N4V6|RS11_RHOPA 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsK PE=1 SV=3 79 193 2.0E-07
sp|A7NR38|RS11_ROSCS 30S ribosomal protein S11 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpsK PE=3 SV=1 77 193 2.0E-07
sp|Q8MCA0|RR11_PHAAN 30S ribosomal protein S11, chloroplastic OS=Phaseolus angularis GN=rps11 PE=3 SV=1 78 193 2.0E-07
sp|P59380|RS11_WIGBR 30S ribosomal protein S11 OS=Wigglesworthia glossinidia brevipalpis GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q749B1|RS11_GEOSL 30S ribosomal protein S11 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|A4QL52|RR11_DRANE 30S ribosomal protein S11, chloroplastic OS=Draba nemorosa GN=rps11 PE=3 SV=1 54 193 3.0E-07
sp|B5ZZ56|RS11_RHILW 30S ribosomal protein S11 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q1MIB8|RS11_RHIL3 30S ribosomal protein S11 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q2K9J3|RS11_RHIEC 30S ribosomal protein S11 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|B3PWU4|RS11_RHIE6 30S ribosomal protein S11 OS=Rhizobium etli (strain CIAT 652) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|B9JDV1|RS11_AGRRK 30S ribosomal protein S11 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q8UE40|RS11_AGRFC 30S ribosomal protein S11 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q2YAX4|RS11_NITMU 30S ribosomal protein S11 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|A4GGD8|RR11_PHAVU 30S ribosomal protein S11, chloroplastic OS=Phaseolus vulgaris GN=rps11 PE=3 SV=1 78 193 3.0E-07
sp|A5ELK4|RS11_BRASB 30S ribosomal protein S11 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|A9H3J3|RS11_GLUDA 30S ribosomal protein S11 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|P59370|RS11_BRADU 30S ribosomal protein S11 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q211H1|RS11_RHOPB 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q1QN07|RS11_NITHX 30S ribosomal protein S11 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q5FU06|RS11_GLUOX 30S ribosomal protein S11 OS=Gluconobacter oxydans (strain 621H) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q2IXN7|RS11_RHOP2 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q07KP1|RS11_RHOP5 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|Q3SSU3|RS11_NITWN 30S ribosomal protein S11 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsK PE=3 SV=1 79 193 3.0E-07
sp|A6U882|RS11_SINMW 30S ribosomal protein S11 OS=Sinorhizobium medicae (strain WSM419) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|C3MB02|RS11_RHISN 30S ribosomal protein S11 OS=Rhizobium sp. (strain NGR234) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q925W7|RS11_RHIME 30S ribosomal protein S11 OS=Rhizobium meliloti (strain 1021) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q0AIH3|RS11_NITEC 30S ribosomal protein S11 OS=Nitrosomonas eutropha (strain C91) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|B1LWQ1|RS11_METRJ 30S ribosomal protein S11 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q2S935|RS11_HAHCH 30S ribosomal protein S11 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q17ZB6|RS11_HELAH 30S ribosomal protein S11 OS=Helicobacter acinonychis (strain Sheeba) GN=rpsK PE=3 SV=1 78 193 4.0E-07
sp|Q82X71|RS11_NITEU 30S ribosomal protein S11 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q31IW0|RS11_THICR 30S ribosomal protein S11 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|A5N4S3|RS11_CLOK5 30S ribosomal protein S11 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|B9DYD5|RS11_CLOK1 30S ribosomal protein S11 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q09G13|RR11_PLAOC 30S ribosomal protein S11, chloroplastic OS=Platanus occidentalis GN=rps11 PE=3 SV=1 54 193 4.0E-07
sp|B2UEJ5|RS11_RALPJ 30S ribosomal protein S11 OS=Ralstonia pickettii (strain 12J) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|B8EIT4|RS11_METSB 30S ribosomal protein S11 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|B1Z770|RS11_METPB 30S ribosomal protein S11 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q5WZI9|RS11_LEGPL 30S ribosomal protein S11 OS=Legionella pneumophila (strain Lens) GN=rpsK PE=3 SV=1 78 193 4.0E-07
sp|Q5ZYM0|RS11_LEGPH 30S ribosomal protein S11 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsK PE=3 SV=1 78 193 4.0E-07
sp|Q5X836|RS11_LEGPA 30S ribosomal protein S11 OS=Legionella pneumophila (strain Paris) GN=rpsK PE=3 SV=1 78 193 4.0E-07
sp|B0K5R9|RS11_THEPX 30S ribosomal protein S11 OS=Thermoanaerobacter sp. (strain X514) GN=rpsK PE=3 SV=1 67 193 4.0E-07
sp|B0KCM6|RS11_THEP3 30S ribosomal protein S11 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsK PE=3 SV=1 67 193 4.0E-07
sp|Q8XV36|RS11_RALSO 30S ribosomal protein S11 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q2LQD1|RS11_SYNAS 30S ribosomal protein S11 OS=Syntrophus aciditrophicus (strain SB) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q605D5|RS11_METCA 30S ribosomal protein S11 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q9BBQ3|RR11_LOTJA 30S ribosomal protein S11, chloroplastic OS=Lotus japonicus GN=rps11 PE=3 SV=1 56 193 4.0E-07
sp|Q8R7Y0|RS11_CALS4 30S ribosomal protein S11 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsK PE=3 SV=1 67 193 4.0E-07
sp|Q0P3L1|RR11_OSTTA 30S ribosomal protein S11, chloroplastic OS=Ostreococcus tauri GN=rps11 PE=3 SV=1 78 193 4.0E-07
sp|B9JVR0|RS11_AGRVS 30S ribosomal protein S11 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsK PE=3 SV=1 79 193 4.0E-07
sp|Q488Z0|RS11_COLP3 30S ribosomal protein S11 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsK PE=3 SV=1 79 193 5.0E-07
sp|Q2PMQ2|RR11_SOYBN 30S ribosomal protein S11, chloroplastic OS=Glycine max GN=rps11 PE=3 SV=1 78 193 5.0E-07
sp|B2S2F9|RS11_TREPS 30S ribosomal protein S11 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsK PE=3 SV=1 67 193 5.0E-07
sp|O83241|RS11_TREPA 30S ribosomal protein S11 OS=Treponema pallidum (strain Nichols) GN=rpsK PE=3 SV=1 67 193 5.0E-07
sp|Q0ANS3|RS11_MARMM 30S ribosomal protein S11 OS=Maricaulis maris (strain MCS10) GN=rpsK PE=3 SV=1 79 193 5.0E-07
sp|Q1IS96|RS11_KORVE 30S ribosomal protein S11 OS=Koribacter versatilis (strain Ellin345) GN=rpsK PE=3 SV=1 79 193 5.0E-07
sp|A0RM34|RS11_CAMFF 30S ribosomal protein S11 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpsK PE=3 SV=1 78 193 5.0E-07
sp|Q09ME4|RR11_CITSI 30S ribosomal protein S11, chloroplastic OS=Citrus sinensis GN=rps11 PE=3 SV=1 78 193 5.0E-07
sp|B4R8P0|RS11_PHEZH 30S ribosomal protein S11 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsK PE=3 SV=1 79 193 5.0E-07
sp|A8LM80|RS11_DINSH 30S ribosomal protein S11 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsK PE=3 SV=1 79 193 6.0E-07
sp|Q0BUM7|RS11_GRABC 30S ribosomal protein S11 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsK PE=3 SV=1 79 193 6.0E-07
sp|Q11HS5|RS11_CHESB 30S ribosomal protein S11 OS=Chelativorans sp. (strain BNC1) GN=rpsK PE=3 SV=1 79 193 6.0E-07
sp|B0Z5G1|RR11_OENPA 30S ribosomal protein S11, chloroplastic OS=Oenothera parviflora GN=rps11 PE=3 SV=1 78 193 7.0E-07
sp|B0Z577|RR11_OENGL 30S ribosomal protein S11, chloroplastic OS=Oenothera glazioviana GN=rps11 PE=3 SV=1 78 193 7.0E-07
sp|Q9MTJ2|RR11_OENEH 30S ribosomal protein S11, chloroplastic OS=Oenothera elata subsp. hookeri GN=rps11 PE=3 SV=2 78 193 7.0E-07
sp|B0Z4Z3|RR11_OENBI 30S ribosomal protein S11, chloroplastic OS=Oenothera biennis GN=rps11 PE=3 SV=1 78 193 7.0E-07
sp|B0Z4Q9|RR11_OENAR 30S ribosomal protein S11, chloroplastic OS=Oenothera argillicola GN=rps11 PE=3 SV=1 78 193 7.0E-07
sp|P49499|RR11_ODOSI 30S ribosomal protein S11, chloroplastic OS=Odontella sinensis GN=rps11 PE=3 SV=1 78 193 7.0E-07
sp|A4QLW6|RR11_NASOF 30S ribosomal protein S11, chloroplastic OS=Nasturtium officinale GN=rps11 PE=3 SV=1 54 193 7.0E-07
sp|A8ETK4|RS11_ARCB4 30S ribosomal protein S11 OS=Arcobacter butzleri (strain RM4018) GN=rpsK PE=3 SV=1 78 193 7.0E-07
sp|Q3J8T6|RS11_NITOC 30S ribosomal protein S11 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsK PE=3 SV=1 79 193 7.0E-07
sp|Q5LW33|RS11_RUEPO 30S ribosomal protein S11 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsK PE=3 SV=1 79 193 7.0E-07
sp|Q98N34|RS11_RHILO 30S ribosomal protein S11 OS=Rhizobium loti (strain MAFF303099) GN=rpsK PE=3 SV=1 79 193 8.0E-07
sp|Q6YQZ6|RS11_ONYPE 30S ribosomal protein S11 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsK PE=3 SV=1 79 192 8.0E-07
sp|Q01WB8|RS11_SOLUE 30S ribosomal protein S11 OS=Solibacter usitatus (strain Ellin6076) GN=rpsK PE=3 SV=1 78 193 8.0E-07
sp|Q6F1W8|RS11_MESFL 30S ribosomal protein S11 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsK PE=3 SV=1 79 192 8.0E-07
sp|A4QK51|RR11_ARAHI 30S ribosomal protein S11, chloroplastic OS=Arabis hirsuta GN=rps11 PE=3 SV=1 54 193 8.0E-07
sp|B0UHU6|RS11_METS4 30S ribosomal protein S11 OS=Methylobacterium sp. (strain 4-46) GN=rpsK PE=3 SV=1 79 193 8.0E-07
sp|A4QJW4|RR11_OLIPU 30S ribosomal protein S11, chloroplastic OS=Olimarabidopsis pumila GN=rps11 PE=3 SV=1 54 193 8.0E-07
sp|A4QLM7|RR11_LOBMA 30S ribosomal protein S11, chloroplastic OS=Lobularia maritima GN=rps11 PE=3 SV=1 54 193 8.0E-07
sp|A4QLD9|RR11_LEPVR 30S ribosomal protein S11, chloroplastic OS=Lepidium virginicum GN=rps11 PE=3 SV=1 54 193 8.0E-07
sp|A4QKW4|RR11_CRUWA 30S ribosomal protein S11, chloroplastic OS=Crucihimalaya wallichii GN=rps11 PE=3 SV=1 54 193 8.0E-07
sp|A4QKM5|RR11_CAPBU 30S ribosomal protein S11, chloroplastic OS=Capsella bursa-pastoris GN=rps11 PE=3 SV=1 54 193 8.0E-07
sp|P56802|RR11_ARATH 30S ribosomal protein S11, chloroplastic OS=Arabidopsis thaliana GN=rps11 PE=3 SV=1 54 193 8.0E-07
sp|Q2NIY0|RS11_AYWBP 30S ribosomal protein S11 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsK PE=3 SV=1 79 192 8.0E-07
sp|B8IT34|RS11_METNO 30S ribosomal protein S11 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsK PE=3 SV=1 79 193 8.0E-07
sp|Q1CRW5|RS11_HELPH 30S ribosomal protein S11 OS=Helicobacter pylori (strain HPAG1) GN=rpsK PE=3 SV=1 78 193 9.0E-07
sp|B6JND5|RS11_HELP2 30S ribosomal protein S11 OS=Helicobacter pylori (strain P12) GN=rpsK PE=3 SV=1 78 193 9.0E-07
sp|P59379|RS11_THEEB 30S ribosomal protein S11 OS=Thermosynechococcus elongatus (strain BP-1) GN=rpsK PE=3 SV=1 79 193 9.0E-07
sp|Q9ZJT3|RS11_HELPJ 30S ribosomal protein S11 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsK PE=3 SV=1 78 193 9.0E-07
sp|B5Z8U4|RS11_HELPG 30S ribosomal protein S11 OS=Helicobacter pylori (strain G27) GN=rpsK PE=3 SV=1 78 193 9.0E-07
sp|Q3A9U2|RS11_CARHZ 30S ribosomal protein S11 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsK PE=3 SV=1 79 193 9.0E-07
sp|Q5WLN6|RS11_BACSK 30S ribosomal protein S11 OS=Bacillus clausii (strain KSM-K16) GN=rpsK PE=3 SV=1 79 193 9.0E-07
sp|P56018|RS11_HELPY 30S ribosomal protein S11 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsK PE=3 SV=1 78 193 1.0E-06
sp|Q9TL27|RR11_NEPOL 30S ribosomal protein S11, chloroplastic OS=Nephroselmis olivacea GN=rps11 PE=3 SV=1 78 193 1.0E-06
sp|C0ZIK6|RS11_BREBN 30S ribosomal protein S11 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|A8ZV80|RS11_DESOH 30S ribosomal protein S11 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rpsK PE=3 SV=1 78 193 1.0E-06
sp|Q5P309|RS11_AROAE 30S ribosomal protein S11 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|A5USG4|RS11_ROSS1 30S ribosomal protein S11 OS=Roseiflexus sp. (strain RS-1) GN=rpsK PE=3 SV=1 77 193 1.0E-06
sp|A6X0E1|RS11_OCHA4 30S ribosomal protein S11 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|P66351|RS11_BRUSU 30S ribosomal protein S11 OS=Brucella suis biovar 1 (strain 1330) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|B0CH08|RS11_BRUSI 30S ribosomal protein S11 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|A5VQY3|RS11_BRUO2 30S ribosomal protein S11 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|P66350|RS11_BRUME 30S ribosomal protein S11 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|C0RJH7|RS11_BRUMB 30S ribosomal protein S11 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|A9M5M6|RS11_BRUC2 30S ribosomal protein S11 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|Q57CT1|RS11_BRUAB 30S ribosomal protein S11 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|Q2YRT9|RS11_BRUA2 30S ribosomal protein S11 OS=Brucella abortus (strain 2308) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|B2S656|RS11_BRUA1 30S ribosomal protein S11 OS=Brucella abortus (strain S19) GN=rpsK PE=3 SV=1 79 193 1.0E-06
sp|P80376|RS11_THET8 30S ribosomal protein S11 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsK PE=1 SV=3 79 192 1.0E-06
sp|P62654|RS11_THET2 30S ribosomal protein S11 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsK PE=1 SV=2 79 192 1.0E-06
sp|P27419|RR11_EUGGR 30S ribosomal protein S11, chloroplastic OS=Euglena gracilis GN=rps11 PE=3 SV=1 78 193 1.0E-06
sp|O66485|RS11_AQUAE 30S ribosomal protein S11 OS=Aquifex aeolicus (strain VF5) GN=rpsK PE=3 SV=1 78 193 1.0E-06
sp|B1NWI3|RR11_MANES 30S ribosomal protein S11, chloroplastic OS=Manihot esculenta GN=rps11 PE=3 SV=1 78 193 1.0E-06
sp|Q6MJ34|RS11_BDEBA 30S ribosomal protein S11 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsK PE=3 SV=1 77 193 1.0E-06
sp|Q9MUU9|RR11_MESVI 30S ribosomal protein S11, chloroplastic OS=Mesostigma viride GN=rps11 PE=3 SV=1 78 193 1.0E-06
sp|B2UV58|RS11_HELPS 30S ribosomal protein S11 OS=Helicobacter pylori (strain Shi470) GN=rpsK PE=3 SV=1 78 193 1.0E-06
sp|Q47J79|RS11_DECAR 30S ribosomal protein S11 OS=Dechloromonas aromatica (strain RCB) GN=rpsK PE=3 SV=1 79 193 2.0E-06
sp|Q824N2|RS11_CHLCV 30S ribosomal protein S11 OS=Chlamydophila caviae (strain GPIC) GN=rpsK PE=3 SV=1 78 193 2.0E-06
sp|B1A968|RR11_CARPA 30S ribosomal protein S11, chloroplastic OS=Carica papaya GN=rps11 PE=3 SV=1 78 193 2.0E-06
sp|Q70XX6|RR11_AMBTC 30S ribosomal protein S11, chloroplastic OS=Amborella trichopoda GN=rps11 PE=3 SV=1 78 159 2.0E-06
sp|A1KB03|RS11_AZOSB 30S ribosomal protein S11 OS=Azoarcus sp. (strain BH72) GN=rpsK PE=3 SV=1 79 193 2.0E-06
sp|Q7M8F5|RS11_WOLSU 30S ribosomal protein S11 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsK PE=3 SV=1 78 193 2.0E-06
sp|Q7VGC1|RS11_HELHP 30S ribosomal protein S11 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsK PE=3 SV=1 85 193 2.0E-06
sp|A4QJN2|RR11_AETGR 30S ribosomal protein S11, chloroplastic OS=Aethionema grandiflorum GN=rps11 PE=3 SV=1 54 193 2.0E-06
sp|A4QJE8|RR11_AETCO 30S ribosomal protein S11, chloroplastic OS=Aethionema cordifolium GN=rps11 PE=3 SV=1 54 193 2.0E-06
sp|B2IF94|RS11_BEII9 30S ribosomal protein S11 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsK PE=3 SV=1 79 193 2.0E-06
sp|A9KJG8|RS11_CLOPH 30S ribosomal protein S11 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpsK PE=3 SV=1 74 193 2.0E-06
sp|Q68WA1|RS11_RICTY 30S ribosomal protein S11 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsK PE=3 SV=1 78 193 2.0E-06
sp|Q9ZCS8|RS11_RICPR 30S ribosomal protein S11 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsK PE=3 SV=1 78 193 2.0E-06
sp|Q9Z7S7|RS11_CHLPN 30S ribosomal protein S11 OS=Chlamydia pneumoniae GN=rpsK PE=3 SV=1 78 193 2.0E-06
sp|Q06GW4|RR11_DRIGR 30S ribosomal protein S11, chloroplastic OS=Drimys granadensis GN=rps11 PE=3 SV=1 78 193 2.0E-06
sp|B7J266|RS11_BORBZ 30S ribosomal protein S11 OS=Borrelia burgdorferi (strain ZS7) GN=rpsK PE=3 SV=1 77 193 2.0E-06
sp|O51454|RS11_BORBU 30S ribosomal protein S11 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsK PE=3 SV=2 77 193 2.0E-06
sp|Q661B9|RS11_BORBP 30S ribosomal protein S11 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsK PE=3 SV=1 77 193 2.0E-06
sp|Q0SN06|RS11_BORAP 30S ribosomal protein S11 OS=Borrelia afzelii (strain PKo) GN=rpsK PE=3 SV=1 77 193 2.0E-06
sp|A9NEF9|RS11_ACHLI 30S ribosomal protein S11 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsK PE=3 SV=1 79 189 2.0E-06
sp|Q6NJ65|RS11_CORDI 30S ribosomal protein S11 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rpsK PE=3 SV=1 77 193 2.0E-06
sp|A9VPA3|RS11_BACWK 30S ribosomal protein S11 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpsK PE=3 SV=1 79 193 2.0E-06
sp|Q252X3|RS11_CHLFF 30S ribosomal protein S11 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsK PE=3 SV=1 78 193 2.0E-06
sp|Q6MSP8|RS11_MYCMS 30S ribosomal protein S11 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpsK PE=3 SV=1 79 191 2.0E-06
sp|Q2SRH8|RS11_MYCCT 30S ribosomal protein S11 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpsK PE=3 SV=1 79 191 2.0E-06
sp|A6T3I0|RS11_JANMA 30S ribosomal protein S11 OS=Janthinobacterium sp. (strain Marseille) GN=rpsK PE=3 SV=1 79 193 3.0E-06
sp|A7ZFY9|RS11_CAMC1 30S ribosomal protein S11 OS=Campylobacter concisus (strain 13826) GN=rpsK PE=3 SV=1 78 193 3.0E-06
sp|Q2G5A9|RS11_NOVAD 30S ribosomal protein S11 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsK PE=3 SV=1 79 193 3.0E-06
sp|Q0ZIY6|RR11_VITVI 30S ribosomal protein S11, chloroplastic OS=Vitis vinifera GN=rps11 PE=3 SV=1 78 193 3.0E-06
sp|B3CT28|RS11_ORITI 30S ribosomal protein S11 OS=Orientia tsutsugamushi (strain Ikeda) GN=rpsK PE=3 SV=1 78 193 3.0E-06
sp|A5CCJ0|RS11_ORITB 30S ribosomal protein S11 OS=Orientia tsutsugamushi (strain Boryong) GN=rpsK PE=3 SV=1 78 193 3.0E-06
sp|Q6G2Y8|RS11_BARHE 30S ribosomal protein S11 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsK PE=3 SV=1 78 193 3.0E-06
sp|C4KZM0|RS11_EXISA 30S ribosomal protein S11 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsK PE=3 SV=1 78 193 3.0E-06
sp|O50633|RS11_BACHD 30S ribosomal protein S11 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsK PE=3 SV=1 79 193 3.0E-06
sp|Q1R0F2|RS11_CHRSD 30S ribosomal protein S11 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsK PE=3 SV=1 79 193 3.0E-06
sp|Q92GY9|RS11_RICCN 30S ribosomal protein S11 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsK PE=3 SV=1 78 193 3.0E-06
sp|C3PP84|RS11_RICAE 30S ribosomal protein S11 OS=Rickettsia africae (strain ESF-5) GN=rpsK PE=3 SV=1 78 193 3.0E-06
sp|Q1MPP3|RS11_LAWIP 30S ribosomal protein S11 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsK PE=3 SV=1 78 193 3.0E-06
sp|A4QKD8|RR11_BARVE 30S ribosomal protein S11, chloroplastic OS=Barbarea verna GN=rps11 PE=3 SV=1 54 193 3.0E-06
sp|Q1H4L3|RS11_METFK 30S ribosomal protein S11 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsK PE=3 SV=1 79 193 3.0E-06
sp|Q5L700|RS11_CHLAB 30S ribosomal protein S11 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsK PE=3 SV=1 78 193 4.0E-06
sp|A6MM69|RR11_BUXMI 30S ribosomal protein S11, chloroplastic OS=Buxus microphylla GN=rps11 PE=3 SV=1 78 193 4.0E-06
sp|A8EZJ3|RS11_RICCK 30S ribosomal protein S11 OS=Rickettsia canadensis (strain McKiel) GN=rpsK PE=3 SV=1 78 193 4.0E-06
sp|A1TYM0|RS11_MARHV 30S ribosomal protein S11 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsK PE=3 SV=1 79 193 4.0E-06
sp|A5FZU2|RS11_ACICJ 30S ribosomal protein S11 OS=Acidiphilium cryptum (strain JF-5) GN=rpsK PE=3 SV=1 79 193 4.0E-06
sp|A8F2C4|RS11_RICM5 30S ribosomal protein S11 OS=Rickettsia massiliae (strain Mtu5) GN=rpsK PE=3 SV=1 78 193 4.0E-06
sp|Q2L937|RR11_GOSHI 30S ribosomal protein S11, chloroplastic OS=Gossypium hirsutum GN=rps11 PE=3 SV=1 56 193 4.0E-06
sp|A0ZZ68|RR11_GOSBA 30S ribosomal protein S11, chloroplastic OS=Gossypium barbadense GN=rps11 PE=3 SV=1 56 193 4.0E-06
sp|A1B051|RS11_PARDP 30S ribosomal protein S11 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsK PE=3 SV=1 79 193 4.0E-06
sp|A7GK46|RS11_BACCN 30S ribosomal protein S11 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsK PE=3 SV=1 79 193 4.0E-06
sp|A4GYU4|RR11_POPTR 30S ribosomal protein S11, chloroplastic OS=Populus trichocarpa GN=rps11 PE=3 SV=1 78 193 4.0E-06
sp|Q14FC4|RR11_POPAL 30S ribosomal protein S11, chloroplastic OS=Populus alba GN=rps11 PE=3 SV=1 78 193 4.0E-06
sp|A5IHP3|RS11_LEGPC 30S ribosomal protein S11 OS=Legionella pneumophila (strain Corby) GN=rpsK PE=3 SV=1 78 193 4.0E-06
sp|B3R016|RS11_PHYMT 30S ribosomal protein S11 OS=Phytoplasma mali (strain AT) GN=rpsK PE=3 SV=1 79 186 4.0E-06
sp|Q9PJN3|RS11_CHLMU 30S ribosomal protein S11 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsK PE=3 SV=1 78 193 4.0E-06
sp|B1VAC2|RS11_PHYAS 30S ribosomal protein S11 OS=Phytoplasma australiense GN=rpsK PE=3 SV=1 75 192 5.0E-06
sp|Q03EE1|RS11_PEDPA 30S ribosomal protein S11 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsK PE=3 SV=1 79 193 5.0E-06
sp|A8GT46|RS11_RICRS 30S ribosomal protein S11 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsK PE=3 SV=1 78 193 5.0E-06
sp|B0BUN7|RS11_RICRO 30S ribosomal protein S11 OS=Rickettsia rickettsii (strain Iowa) GN=rpsK PE=3 SV=1 78 193 5.0E-06
sp|Q30TS5|RS11_SULDN 30S ribosomal protein S11 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsK PE=3 SV=1 78 193 5.0E-06
sp|Q20F03|RR11_OLTVI 30S ribosomal protein S11, chloroplastic OS=Oltmannsiellopsis viridis GN=rps11 PE=3 SV=1 61 193 5.0E-06
sp|A9W4R7|RS11_METEP 30S ribosomal protein S11 OS=Methylobacterium extorquens (strain PA1) GN=rpsK PE=3 SV=1 79 193 6.0E-06
sp|B7L0S7|RS11_METC4 30S ribosomal protein S11 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsK PE=3 SV=1 79 193 6.0E-06
sp|P04969|RS11_BACSU 30S ribosomal protein S11 OS=Bacillus subtilis (strain 168) GN=rpsK PE=1 SV=1 79 193 6.0E-06
sp|P9WH65|RS11_MYCTU 30S ribosomal protein S11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsK PE=1 SV=1 79 193 6.0E-06
sp|P9WH64|RS11_MYCTO 30S ribosomal protein S11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsK PE=3 SV=1 79 193 6.0E-06
sp|A5U8D5|RS11_MYCTA 30S ribosomal protein S11 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpsK PE=3 SV=1 79 193 6.0E-06
sp|A6MMX7|RR11_ILLOL 30S ribosomal protein S11, chloroplastic OS=Illicium oligandrum GN=rps11 PE=3 SV=1 78 193 6.0E-06
sp|Q85FU4|RR11_CYAME 30S ribosomal protein S11, chloroplastic OS=Cyanidioschyzon merolae GN=rps11 PE=3 SV=1 78 193 6.0E-06
sp|A1KRJ7|RS11_NEIMF 30S ribosomal protein S11 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsK PE=3 SV=1 78 193 6.0E-06
sp|P66355|RS11_NEIMB 30S ribosomal protein S11 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsK PE=3 SV=1 78 193 6.0E-06
sp|P66354|RS11_NEIMA 30S ribosomal protein S11 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsK PE=3 SV=1 78 193 6.0E-06
sp|A9M3U2|RS11_NEIM0 30S ribosomal protein S11 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsK PE=3 SV=1 78 193 6.0E-06
sp|Q5F5V0|RS11_NEIG1 30S ribosomal protein S11 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsK PE=3 SV=1 78 193 6.0E-06
sp|Q0G9I6|RR11_LIRTU 30S ribosomal protein S11, chloroplastic OS=Liriodendron tulipifera GN=rps11 PE=3 SV=1 78 193 6.0E-06
sp|B3TN82|RR11_BRADI 30S ribosomal protein S11, chloroplastic OS=Brachypodium distachyon GN=rps11 PE=3 SV=1 55 193 6.0E-06
sp|Q88XW1|RS11_LACPL 30S ribosomal protein S11 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsK PE=3 SV=1 79 193 7.0E-06
sp|Q95H53|RR11_WHEAT 30S ribosomal protein S11, chloroplastic OS=Triticum aestivum GN=rps11 PE=3 SV=1 55 193 7.0E-06
sp|A8Y9B9|RR11_LOLPR 30S ribosomal protein S11, chloroplastic OS=Lolium perenne GN=rps11 PE=3 SV=1 55 193 7.0E-06
sp|A1E9M3|RR11_HORVU 30S ribosomal protein S11, chloroplastic OS=Hordeum vulgare GN=rps11 PE=3 SV=1 55 193 7.0E-06
sp|A1EA41|RR11_AGRST 30S ribosomal protein S11, chloroplastic OS=Agrostis stolonifera GN=rps11 PE=3 SV=1 55 193 7.0E-06
sp|B9DM52|RS11_STACT 30S ribosomal protein S11 OS=Staphylococcus carnosus (strain TM300) GN=rpsK PE=3 SV=1 79 193 7.0E-06
sp|C4K2F6|RS11_RICPU 30S ribosomal protein S11 OS=Rickettsia peacockii (strain Rustic) GN=rpsK PE=3 SV=1 78 193 7.0E-06
sp|Q4UMQ6|RS11_RICFE 30S ribosomal protein S11 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsK PE=3 SV=1 78 193 7.0E-06
sp|Q49ZE3|RS11_STAS1 30S ribosomal protein S11 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsK PE=3 SV=1 79 193 7.0E-06
sp|C4LKZ3|RS11_CORK4 30S ribosomal protein S11 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpsK PE=3 SV=1 77 193 7.0E-06
sp|A8LB07|RS11_FRASN 30S ribosomal protein S11 OS=Frankia sp. (strain EAN1pec) GN=rpsK PE=3 SV=1 77 193 7.0E-06
sp|A1E9V7|RR11_SORBI 30S ribosomal protein S11, chloroplastic OS=Sorghum bicolor GN=rps11 PE=3 SV=1 55 193 7.0E-06
sp|Q6ENT1|RR11_SACOF 30S ribosomal protein S11, chloroplastic OS=Saccharum officinarum GN=rps11 PE=3 SV=1 55 193 7.0E-06
sp|Q6L369|RR11_SACHY 30S ribosomal protein S11, chloroplastic OS=Saccharum hybrid GN=rps11 PE=3 SV=1 55 193 7.0E-06
sp|A8Z689|RS11_SULMW 30S ribosomal protein S11 OS=Sulcia muelleri (strain GWSS) GN=rpsK PE=3 SV=1 79 193 7.0E-06
sp|Q5Z1L1|RS11_NOCFA 30S ribosomal protein S11 OS=Nocardia farcinica (strain IFM 10152) GN=rpsK PE=3 SV=1 79 193 8.0E-06
sp|B1HMV6|RS11_LYSSC 30S ribosomal protein S11 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsK PE=3 SV=1 79 193 8.0E-06
sp|P0C464|RR11_ORYSJ 30S ribosomal protein S11, chloroplastic OS=Oryza sativa subsp. japonica GN=rps11 PE=3 SV=1 55 193 8.0E-06
sp|P0C463|RR11_ORYSI 30S ribosomal protein S11, chloroplastic OS=Oryza sativa subsp. indica GN=rps11 PE=3 SV=1 55 193 8.0E-06
sp|P0C462|RR11_ORYSA 30S ribosomal protein S11, chloroplastic OS=Oryza sativa GN=rps11 PE=3 SV=1 55 193 8.0E-06
sp|Q6ENE1|RR11_ORYNI 30S ribosomal protein S11, chloroplastic OS=Oryza nivara GN=rps11 PE=3 SV=1 55 193 8.0E-06
sp|P09561|RR11_MAIZE 30S ribosomal protein S11, chloroplastic OS=Zea mays GN=rps11 PE=3 SV=2 55 193 8.0E-06
sp|A7H5U3|RS11_CAMJD 30S ribosomal protein S11 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsK PE=3 SV=1 78 193 8.0E-06
sp|P82911|RT11_BOVIN 28S ribosomal protein S11, mitochondrial OS=Bos taurus GN=MRPS11 PE=1 SV=2 79 193 8.0E-06
sp|A4IZR1|RS11_FRATW 30S ribosomal protein S11 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsK PE=3 SV=1 79 193 8.0E-06
sp|Q5NHU5|RS11_FRATT 30S ribosomal protein S11 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsK PE=3 SV=1 79 193 8.0E-06
sp|A0Q4K6|RS11_FRATN 30S ribosomal protein S11 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsK PE=3 SV=1 79 193 8.0E-06
sp|Q14J97|RS11_FRAT1 30S ribosomal protein S11 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsK PE=3 SV=1 79 193 8.0E-06
sp|A9IVZ7|RS11_BART1 30S ribosomal protein S11 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsK PE=3 SV=1 78 193 8.0E-06
sp|B2XWQ6|RR11_FAGEA 30S ribosomal protein S11, chloroplastic OS=Fagopyrum esculentum subsp. ancestrale GN=rps11 PE=3 SV=1 56 193 8.0E-06
sp|Q16AB9|RS11_ROSDO 30S ribosomal protein S11 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsK PE=3 SV=1 79 193 8.0E-06
sp|Q672I7|RR11_PENAM 30S ribosomal protein S11, chloroplastic OS=Pennisetum americanum GN=rps11 PE=3 SV=1 55 193 8.0E-06
sp|A8F9B1|RS11_BACP2 30S ribosomal protein S11 OS=Bacillus pumilus (strain SAFR-032) GN=rpsK PE=3 SV=1 79 193 9.0E-06
sp|Q0BNQ5|RS11_FRATO 30S ribosomal protein S11 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsK PE=3 SV=1 79 193 9.0E-06
sp|Q2A5E7|RS11_FRATH 30S ribosomal protein S11 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsK PE=3 SV=1 79 193 9.0E-06
sp|A7N9U7|RS11_FRATF 30S ribosomal protein S11 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsK PE=3 SV=1 79 193 9.0E-06
sp|C1DAU1|RS11_LARHH 30S ribosomal protein S11 OS=Laribacter hongkongensis (strain HLHK9) GN=rpsK PE=3 SV=1 79 193 9.0E-06
sp|A6MMF5|RR11_CHLSC 30S ribosomal protein S11, chloroplastic OS=Chloranthus spicatus GN=rps11 PE=3 SV=1 78 193 9.0E-06
sp|B9KEH4|RS11_CAMLR 30S ribosomal protein S11 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpsK PE=3 SV=1 78 193 9.0E-06
sp|P0CE03|RS11_CHLTR 30S ribosomal protein S11 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsK PE=3 SV=1 78 193 9.0E-06
sp|Q09WY4|RR11_MORIN 30S ribosomal protein S11, chloroplastic OS=Morus indica GN=rps11 PE=3 SV=1 56 193 9.0E-06
sp|Q3KLI9|RS11_CHLTA 30S ribosomal protein S11 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsK PE=3 SV=1 78 193 9.0E-06
sp|A7H0Z1|RS11_CAMC5 30S ribosomal protein S11 OS=Campylobacter curvus (strain 525.92) GN=rpsK PE=3 SV=1 78 193 9.0E-06
sp|B8E1F8|RS11_DICTD 30S ribosomal protein S11 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsK PE=3 SV=1 61 193 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043229 intracellular organelle No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8499
MLRDLYGDPSKSAPAARRPAPAARPPLPASLKSNDHLSNQVSMALKSAKVDLGVLKLGINQNRPAAEKKEPEPDP
FHLHVYSHKHNTHITFTRPNRNPIVSLSCGNIGFRKSRRGTFDAAYSLTKYALEKVSDAKLKIESLELVLKGFGQ
GREAAVKVLLGPEGKALRDKIIRVADATKIKFGGTRSEKPRRL*
Coding >Hirsu2|8499
ATGCTGCGGGATCTCTACGGCGACCCCAGCAAGTCCGCTCCCGCCGCCAGGAGGCCCGCTCCGGCTGCCAGGCCG
CCTTTGCCCGCCAGCCTCAAGTCCAACGACCACCTGTCCAACCAGGTTTCCATGGCCCTGAAGTCGGCCAAGGTC
GACCTGGGCGTGCTCAAGCTGGGCATCAACCAGAACAGGCCGGCGGCGGAGAAGAAGGAGCCGGAGCCGGACCCG
TTCCATCTCCACGTCTACTCGCACAAGCACAACACCCACATCACCTTCACGCGGCCGAACCGCAACCCCATCGTC
TCGCTCTCGTGCGGCAACATCGGCTTCCGCAAGTCCCGGCGCGGCACCTTCGACGCGGCCTACTCGCTGACAAAG
TACGCGCTGGAGAAGGTCAGCGACGCCAAGCTTAAGATCGAAAGCCTCGAGCTCGTGCTTAAGGGCTTCGGCCAG
GGCAGGGAAGCCGCCGTCAAGGTCCTGTTGGGTCCCGAGGGCAAGGCCCTGCGCGACAAGATCATCCGAGTGGCC
GACGCGACCAAGATCAAGTTTGGTGGCACGAGGAGCGAGAAACCCAGACGACTTTAA
Transcript >Hirsu2|8499
ATGCTGCGGGATCTCTACGGCGACCCCAGCAAGTCCGCTCCCGCCGCCAGGAGGCCCGCTCCGGCTGCCAGGCCG
CCTTTGCCCGCCAGCCTCAAGTCCAACGACCACCTGTCCAACCAGGTTTCCATGGCCCTGAAGTCGGCCAAGGTC
GACCTGGGCGTGCTCAAGCTGGGCATCAACCAGAACAGGCCGGCGGCGGAGAAGAAGGAGCCGGAGCCGGACCCG
TTCCATCTCCACGTCTACTCGCACAAGCACAACACCCACATCACCTTCACGCGGCCGAACCGCAACCCCATCGTC
TCGCTCTCGTGCGGCAACATCGGCTTCCGCAAGTCCCGGCGCGGCACCTTCGACGCGGCCTACTCGCTGACAAAG
TACGCGCTGGAGAAGGTCAGCGACGCCAAGCTTAAGATCGAAAGCCTCGAGCTCGTGCTTAAGGGCTTCGGCCAG
GGCAGGGAAGCCGCCGTCAAGGTCCTGTTGGGTCCCGAGGGCAAGGCCCTGCGCGACAAGATCATCCGAGTGGCC
GACGCGACCAAGATCAAGTTTGGTGGCACGAGGAGCGAGAAACCCAGACGACTTTAA
Gene >Hirsu2|8499
ATGCTGCGGGATCTCTACGGCGACCCCAGCAAGTCCGCTCCCGCCGCCAGGAGGCCCGCTCCGGCTGCCAGGCCG
CCTTTGCCCGCCAGCCTCAAGTCCAACGACCACCTGTCCAACCAGGTTTCCATGGCCCTGAAGTCGGCCAAGGTC
GACCTGGGCGTGCTCAAGCTGGGCATCAACCAGAACAGGCCGGCGGCGGAGAAGAAGGAGCCGGAGCCGGACCCG
TTCCATCTCCACGTCTACTCGCACAAGCACAACACCCACATCACCTTCACGCGGCCGAACCGCAACCCCATCGTC
TCGCTCTCGTGCGGCAACATCGGCTTCCGCAAGTCCCGGCGCGGCACCTTCGACGCGGCCTACTCGCTGACAAAG
TACGCGCTGGAGAAGGTCAGCGACGCCAAGCTTAAGATCGAAAGCCTCGAGCTCGTGCTTAAGGGCTTCGGCCAG
GGCAGGGAAGCCGCCGTCAAGGTCCTGTTGGGTCCCGAGGGCAAGGCCCTGCGCGACAAGATCATCCGAGTGGCC
GACGCGACCAAGATCAAGTTTGGTGGCACGAGGAGCGAGAAACCCAGACGACTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail