Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8478
Gene name
LocationContig_557:5062..5902
Strand+
Gene length (bp)840
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 3.3E-25 25 266
PF00106 adh_short short chain dehydrogenase 1.4E-16 17 218

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 12 266 1.0E-20
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 13 269 1.0E-13
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 12 266 3.0E-13
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 11 266 4.0E-13
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 5 269 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 12 266 1.0E-20
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 13 269 1.0E-13
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 12 266 3.0E-13
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 11 266 4.0E-13
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 5 269 5.0E-13
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 11 266 8.0E-13
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 12 266 9.0E-13
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 12 266 3.0E-12
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 20 266 3.0E-12
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 11 268 5.0E-12
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 10 270 1.0E-11
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 10 270 1.0E-11
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 1 270 2.0E-11
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 20 266 3.0E-11
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 8 266 7.0E-11
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 1 269 1.0E-10
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 13 266 4.0E-10
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 7 266 4.0E-10
sp|Q13268|DHRS2_HUMAN Dehydrogenase/reductase SDR family member 2, mitochondrial OS=Homo sapiens GN=DHRS2 PE=1 SV=4 13 244 5.0E-10
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 13 267 6.0E-10
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 13 266 8.0E-10
sp|P39333|BDCA_ECOLI Cyclic-di-GMP-binding biofilm dispersal mediator protein OS=Escherichia coli (strain K12) GN=bdcA PE=1 SV=2 13 265 2.0E-09
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 13 266 2.0E-09
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 13 266 4.0E-09
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 13 253 5.0E-09
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 13 255 8.0E-09
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 12 266 1.0E-08
sp|P0CG22|DR4L1_HUMAN Putative dehydrogenase/reductase SDR family member 4-like 1 OS=Homo sapiens GN=DHRS4L1 PE=5 SV=1 13 266 2.0E-08
sp|Q6PKH6|DR4L2_HUMAN Dehydrogenase/reductase SDR family member 4-like 2 OS=Homo sapiens GN=DHRS4L2 PE=2 SV=1 13 205 2.0E-08
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 13 267 2.0E-08
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 16 266 4.0E-08
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 13 269 7.0E-08
sp|Q5RCH8|PECR_PONAB Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 13 267 8.0E-08
sp|P52037|YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 19 267 1.0E-07
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 20 266 2.0E-07
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 3 222 2.0E-07
sp|Q9S9W2|SDRA_ARATH Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana GN=SDRA PE=1 SV=1 8 212 3.0E-07
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 12 253 4.0E-07
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 13 266 5.0E-07
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 15 269 5.0E-07
sp|Q6CEE9|SDR_YARLI Probable NADP-dependent mannitol dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B16192g PE=1 SV=1 13 266 6.0E-07
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 9 276 8.0E-07
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 13 266 9.0E-07
sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 6 266 9.0E-07
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 12 268 1.0E-06
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 12 269 1.0E-06
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 16 266 1.0E-06
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 13 266 1.0E-06
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 13 248 2.0E-06
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 13 248 2.0E-06
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 12 266 2.0E-06
sp|Q1RKB7|FABG_RICBR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia bellii (strain RML369-C) GN=fabG PE=3 SV=1 39 269 2.0E-06
sp|Q92GE0|FABG_RICCN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fabG PE=3 SV=2 39 269 2.0E-06
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 12 266 3.0E-06
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 19 278 3.0E-06
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 13 269 3.0E-06
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 12 252 4.0E-06
sp|Q99MZ7|PECR_MOUSE Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus GN=Pecr PE=1 SV=1 31 267 5.0E-06
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 12 278 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8478
MTPPPALKYTNKLQGRRVLVLGGSTGVGFCVAEAALEHGAHVTISSSNQKKLDAAVARLRKHAQAVGIAAVDSVV
NAKTCDLASPEAVEDNIVSLLEFAVRDGKLDHVVFTAGDALSIVPVGDITAADVQRMGMVRHVGPIVLAKHLPKY
INQAVGSSFTLTGGSNAWRPGPGWSVAASFGAALEGLARGLAIDLRPVRVNCVQLGAVHTELFGGIPEDKLPAVL
DSFRKEGITGTVGKPEEVAEAYIYCMKDSFATGAVVESNGGRLVGDLKGSFLFA*
Coding >Hirsu2|8478
ATGACGCCGCCGCCGGCTCTCAAGTACACCAATAAACTCCAGGGCCGCCGCGTCCTCGTCCTCGGCGGCTCCACC
GGCGTCGGCTTCTGCGTAGCCGAGGCCGCTCTCGAGCACGGCGCCCACGTCACCATCAGCAGCTCCAATCAGAAG
AAGCTGGACGCGGCCGTGGCGCGCCTCCGGAAACACGCGCAAGCCGTCGGCATCGCGGCGGTGGACAGCGTCGTC
AACGCCAAGACGTGCGACTTGGCCAGCCCCGAGGCCGTCGAGGACAACATCGTCTCGCTCCTCGAGTTTGCGGTC
CGGGATGGGAAGCTGGACCACGTCGTCTTCACGGCAGGCGACGCCCTCAGCATAGTCCCCGTCGGGGACATCACC
GCCGCCGACGTCCAGCGCATGGGCATGGTCCGCCACGTCGGGCCCATCGTCCTGGCCAAGCACCTCCCAAAGTAC
ATCAATCAGGCCGTCGGCAGCTCCTTCACCCTGACGGGCGGCAGCAATGCGTGGCGCCCCGGCCCGGGCTGGAGC
GTGGCGGCCAGCTTCGGAGCCGCGCTCGAGGGCCTCGCCCGTGGCCTCGCCATCGACCTGAGGCCTGTCCGGGTG
AACTGCGTCCAGCTCGGGGCGGTCCACACCGAGCTCTTCGGCGGCATCCCCGAAGACAAGCTGCCGGCTGTGCTG
GACAGTTTCCGCAAAGAAGGCATCACGGGCACCGTCGGAAAGCCCGAAGAGGTGGCAGAGGCCTATATCTATTGC
ATGAAGGACTCTTTTGCGACAGGCGCTGTTGTGGAGTCGAACGGGGGTCGTCTGGTGGGCGACCTGAAAGGCAGC
TTTCTCTTCGCTTGA
Transcript >Hirsu2|8478
ATGACGCCGCCGCCGGCTCTCAAGTACACCAATAAACTCCAGGGCCGCCGCGTCCTCGTCCTCGGCGGCTCCACC
GGCGTCGGCTTCTGCGTAGCCGAGGCCGCTCTCGAGCACGGCGCCCACGTCACCATCAGCAGCTCCAATCAGAAG
AAGCTGGACGCGGCCGTGGCGCGCCTCCGGAAACACGCGCAAGCCGTCGGCATCGCGGCGGTGGACAGCGTCGTC
AACGCCAAGACGTGCGACTTGGCCAGCCCCGAGGCCGTCGAGGACAACATCGTCTCGCTCCTCGAGTTTGCGGTC
CGGGATGGGAAGCTGGACCACGTCGTCTTCACGGCAGGCGACGCCCTCAGCATAGTCCCCGTCGGGGACATCACC
GCCGCCGACGTCCAGCGCATGGGCATGGTCCGCCACGTCGGGCCCATCGTCCTGGCCAAGCACCTCCCAAAGTAC
ATCAATCAGGCCGTCGGCAGCTCCTTCACCCTGACGGGCGGCAGCAATGCGTGGCGCCCCGGCCCGGGCTGGAGC
GTGGCGGCCAGCTTCGGAGCCGCGCTCGAGGGCCTCGCCCGTGGCCTCGCCATCGACCTGAGGCCTGTCCGGGTG
AACTGCGTCCAGCTCGGGGCGGTCCACACCGAGCTCTTCGGCGGCATCCCCGAAGACAAGCTGCCGGCTGTGCTG
GACAGTTTCCGCAAAGAAGGCATCACGGGCACCGTCGGAAAGCCCGAAGAGGTGGCAGAGGCCTATATCTATTGC
ATGAAGGACTCTTTTGCGACAGGCGCTGTTGTGGAGTCGAACGGGGGTCGTCTGGTGGGCGACCTGAAAGGCAGC
TTTCTCTTCGCTTGA
Gene >Hirsu2|8478
ATGACGCCGCCGCCGGCTCTCAAGTACACCAATAAACTCCAGGGCCGCCGCGTCCTCGTCCTCGGCGGCTCCACC
GGCGTCGGCTTCTGCGTAGCCGAGGCCGCTCTCGAGCACGGCGCCCACGTCACCATCAGCAGCTCCAATCAGAAG
AAGCTGGACGCGGCCGTGGCGCGCCTCCGGAAACACGCGCAAGCCGTCGGCATCGCGGCGGTGGACAGCGTCGTC
AACGCCAAGACGTGCGACTTGGCCAGCCCCGAGGCCGTCGAGGACAACATCGTCTCGCTCCTCGAGTTTGCGGTC
CGGGATGGGAAGCTGGACCACGTCGTCTTCACGGCAGGCGACGCCCTCAGCATAGTCCCCGTCGGGGACATCACC
GCCGCCGACGTCCAGCGCATGGGCATGGTCCGCCACGTCGGGCCCATCGTCCTGGCCAAGCACCTCCCAAAGTAC
ATCAATCAGGCCGTCGGCAGCTCCTTCACCCTGACGGGCGGCAGCAATGCGTGGCGCCCCGGCCCGGGCTGGAGC
GTGGCGGCCAGCTTCGGAGCCGCGCTCGAGGGCCTCGCCCGTGGCCTCGCCATCGACCTGAGGCCTGTCCGGGTG
AACTGCGTCCAGCTCGGGGCGGTCCACACCGAGCTCTTCGGCGGCATCCCCGAAGACAAGCTGCCGGCTGTGCTG
GACAGTTTCCGCAAAGAAGGCATCACGGGCACCGTCGGAAAGCCCGAAGAGGTGGCAGAGGCCTATATCTATTGC
ATGAAGGACTCTTTTGCGACAGGCGCTGTTGTGGAGTCGAACGGGGGTCGTCTGGTGGGCGACCTGAAAGGCAGC
TTTCTCTTCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail