Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8476
Gene name
LocationContig_557:729..2477
Strand-
Gene length (bp)1748
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.5E-05 12 71

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 118 140 22
3 161 183 22
4 198 220 22
5 281 298 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8476
MASPQEAGRPDLARLPSCALGCLTASCPISDLTCICRAGFHGVEEQRSRCIIHSCGFQSSLYIRNQTATACLAPV
RDQAVYFNAMTAAVVSATGVAVAVRLGFKQFFGAGRRRLGVDDWFAALATLVGVPCIAILVFGLNRHGLGRDIWA
LDDARDAAAFALYFYVMEILYLTVIALVRLTFTLFYLDIFPGRTTRRLLWATVAFHVVVAVAFVAKVVFQCAPVS
YSWTKFLDGPRPAGRCIHINPSSWANAALGVAADLWLLAIPLTQLRRLQLHWKKKVGAGLMFAAGAIGTIVSILR
LRSIVNFANSTNPTWEQYDIVVWSSIEVQVGLTCSCLPTIRLVLVRLWPRIFGVGSQIRSRSNGSQPVEARPGGS
RQRAEPDTMGEPSPSPPARVYYSKPDPAEVPAAPGPGPPPPLRDDGCDDGLVELWSRQRQQMADNRRHGRIFELA
PHAI*
Coding >Hirsu2|8476
ATGGCCTCGCCGCAAGAAGCAGGCCGGCCCGACCTGGCCAGGCTTCCTTCGTGTGCCCTCGGCTGCCTGACGGCG
TCTTGTCCCATCTCGGACCTGACATGCATATGCCGCGCCGGCTTCCACGGCGTGGAGGAGCAGAGGAGCAGATGC
ATCATCCACTCCTGCGGCTTCCAGTCTTCGCTCTACATCCGGAACCAGACGGCGACGGCGTGCCTGGCGCCGGTG
CGGGACCAGGCCGTCTACTTCAACGCGATGACGGCGGCGGTGGTGTCGGCGACGGGCGTCGCGGTCGCGGTCCGG
CTCGGCTTCAAGCAGTTCTTCGGCGCCGGGCGGCGGCGGCTGGGCGTCGACGACTGGTTCGCGGCGCTGGCGACG
CTCGTCGGCGTGCCCTGCATCGCCATCCTCGTCTTCGGCCTCAACCGGCACGGGCTGGGGCGCGACATCTGGGCG
CTCGACGACGCGCGCGACGCCGCCGCCTTCGCCCTCTACTTCTACGTCATGGAGATACTGTACCTGACCGTCATC
GCCCTCGTCCGCCTCACCTTCACCCTCTTCTACCTCGACATCTTCCCCGGCCGGACGACGCGCCGGCTGCTCTGG
GCCACCGTCGCCTTCCACGTCGTCGTCGCCGTCGCCTTCGTCGCAAAGGTCGTCTTCCAGTGCGCGCCCGTCAGC
TACAGCTGGACCAAGTTCCTCGACGGGCCGCGGCCCGCCGGCCGCTGCATCCACATCAACCCGTCCAGCTGGGCC
AACGCGGCGCTCGGCGTCGCCGCCGACCTGTGGCTGCTGGCCATTCCGCTGACGCAGCTGCGGAGGCTGCAGCTT
CACTGGAAGAAGAAGGTCGGGGCCGGCTTGATGTTTGCGGCCGGCGCCATCGGCACCATCGTCTCCATCCTCCGG
CTGCGGTCCATCGTCAACTTCGCCAACTCGACGAACCCGACGTGGGAGCAGTACGACATCGTCGTCTGGTCCTCC
ATCGAGGTCCAGGTCGGCCTGACGTGTTCCTGCCTGCCCACCATCCGCCTCGTCCTCGTCCGGCTGTGGCCGCGC
ATCTTCGGCGTCGGCTCGCAGATCCGGTCCCGGTCCAACGGCTCGCAGCCGGTCGAGGCGAGGCCGGGCGGCAGC
CGGCAGCGCGCCGAGCCGGACACGATGGGCGAGCCGAGTCCGAGCCCGCCGGCCCGCGTCTACTACAGCAAGCCC
GACCCGGCCGAGGTCCCGGCGGCCCCGGGCCCGGGCCCGCCGCCGCCGCTGCGGGACGACGGCTGCGACGACGGC
CTTGTGGAGCTGTGGAGCAGGCAGAGGCAGCAGATGGCCGACAACCGGAGACACGGCCGGATCTTCGAGCTCGCG
CCGCACGCCATATAG
Transcript >Hirsu2|8476
ATGGCCTCGCCGCAAGAAGCAGGCCGGCCCGACCTGGCCAGGCTTCCTTCGTGTGCCCTCGGCTGCCTGACGGCG
TCTTGTCCCATCTCGGACCTGACATGCATATGCCGCGCCGGCTTCCACGGCGTGGAGGAGCAGAGGAGCAGATGC
ATCATCCACTCCTGCGGCTTCCAGTCTTCGCTCTACATCCGGAACCAGACGGCGACGGCGTGCCTGGCGCCGGTG
CGGGACCAGGCCGTCTACTTCAACGCGATGACGGCGGCGGTGGTGTCGGCGACGGGCGTCGCGGTCGCGGTCCGG
CTCGGCTTCAAGCAGTTCTTCGGCGCCGGGCGGCGGCGGCTGGGCGTCGACGACTGGTTCGCGGCGCTGGCGACG
CTCGTCGGCGTGCCCTGCATCGCCATCCTCGTCTTCGGCCTCAACCGGCACGGGCTGGGGCGCGACATCTGGGCG
CTCGACGACGCGCGCGACGCCGCCGCCTTCGCCCTCTACTTCTACGTCATGGAGATACTGTACCTGACCGTCATC
GCCCTCGTCCGCCTCACCTTCACCCTCTTCTACCTCGACATCTTCCCCGGCCGGACGACGCGCCGGCTGCTCTGG
GCCACCGTCGCCTTCCACGTCGTCGTCGCCGTCGCCTTCGTCGCAAAGGTCGTCTTCCAGTGCGCGCCCGTCAGC
TACAGCTGGACCAAGTTCCTCGACGGGCCGCGGCCCGCCGGCCGCTGCATCCACATCAACCCGTCCAGCTGGGCC
AACGCGGCGCTCGGCGTCGCCGCCGACCTGTGGCTGCTGGCCATTCCGCTGACGCAGCTGCGGAGGCTGCAGCTT
CACTGGAAGAAGAAGGTCGGGGCCGGCTTGATGTTTGCGGCCGGCGCCATCGGCACCATCGTCTCCATCCTCCGG
CTGCGGTCCATCGTCAACTTCGCCAACTCGACGAACCCGACGTGGGAGCAGTACGACATCGTCGTCTGGTCCTCC
ATCGAGGTCCAGGTCGGCCTGACGTGTTCCTGCCTGCCCACCATCCGCCTCGTCCTCGTCCGGCTGTGGCCGCGC
ATCTTCGGCGTCGGCTCGCAGATCCGGTCCCGGTCCAACGGCTCGCAGCCGGTCGAGGCGAGGCCGGGCGGCAGC
CGGCAGCGCGCCGAGCCGGACACGATGGGCGAGCCGAGTCCGAGCCCGCCGGCCCGCGTCTACTACAGCAAGCCC
GACCCGGCCGAGGTCCCGGCGGCCCCGGGCCCGGGCCCGCCGCCGCCGCTGCGGGACGACGGCTGCGACGACGGC
CTTGTGGAGCTGTGGAGCAGGCAGAGGCAGCAGATGGCCGACAACCGGAGACACGGCCGGATCTTCGAGCTCGCG
CCGCACGCCATATAG
Gene >Hirsu2|8476
ATGGCCTCGCCGCAAGAAGCAGGCCGGCCCGACCTGGCCAGGCTTCCTTCGTGTGCCGTGAGTTTTTTTTCTTTT
TCGTCCTCGTCCTCGTCCTCGTCCTCCTGCACCTCCTCCTTGCTTCTCATGATCTCTCTGGCTCGCTTCTTTCTG
CTAACGCGCGGTCGACGCGGCACGCACAGCTCGGCTGCCTGACGGCGTCTTGTCCCATCTCGGACCTGACATGCA
TATGCCGCGCCGGCTTCCACGGCGTGGAGGAGCAGAGGAGCAGATGCATCATCCACTCCTGCGGCTTCCAGTCTT
CGCTCTGTGCGTAACAAACCAGCCCGGGCCCCGATCCGAATCCCGATCGAGAGGGAGAAGGCACGAAGAGACAGG
GGGGGGGGACAGACAGAGCGGAAGAGACTGACCGGAGGCGCGGACGGAGCAGACATCCGGAACCAGACGGCGACG
GCGTGCCTGGCGCCGGTGCGGGACCAGGCCGTCTACTTCAACGCGATGACGGCGGCGGTGGTGTCGGCGACGGGC
GTCGCGGTCGCGGTCCGGCTCGGCTTCAAGCAGTTCTTCGGCGCCGGGCGGCGGCGGCTGGGCGTCGACGACTGG
TTCGCGGCGCTGGCGACGCTCGTCGGCGTGCCCTGCATCGCCATCCTCGTCTTCGGCCTCAACCGGCACGGGCTG
GGGCGCGACATCTGGGCGCTCGACGACGCGCGCGACGCCGCCGCCTTCGCCCTCTACTTCTACGTCATGGAGATA
CTGTACCTGACCGTCATCGCCCTCGTCCGCCTCACCTTCACCCTCTTCTACCTCGACATCTTCCCCGGCCGGACG
ACGCGCCGGCTGCTCTGGGCCACCGTCGCCTTCCACGTCGTCGTCGCCGTCGCCTTCGTCGCAAAGGTCGTCTTC
CAGTGCGCGCCCGTCAGCTACAGCTGGACCAAGTTCCTCGACGGGCCGCGGCCCGCCGGCCGCTGCATCCACATC
AACCCGTCCAGCTGGGCCAACGCGGCGCTCGGCGTCGCCGCCGACCTGTGGCTGCTGGCCATTCCGCTGACGCAG
CTGCGGAGGCTGCAGCTTCACTGGAAGAAGAAGGTCGGGGCCGGCTTGATGTTTGCGGCCGGCGCCATGTGAGTC
GAGCGTCTCCCCCCTTTTCTCTGTGTCACTCTCCCCTGCTCCGCCTCCATCTCCCCTCCTCTCTTCTTCTTCTCC
AATGTAGCATCATGAAGAAAGGGGGTGCTGACCGAGGCGCGTCTCCTCTCCTCTTCAGCGGCACCATCGTCTCCA
TCCTCCGGCTGCGGTCCATCGTCAACTTCGCCAACTCGACGAACCCGACGTGGGAGCAGTACGACATCGTCGTCT
GGTCCTCCATCGAGGTCCAGGTCGGCCTGACGTGTTCCTGCCTGCCCACCATCCGCCTCGTCCTCGTCCGGCTGT
GGCCGCGCATCTTCGGCGTCGGCTCGCAGATCCGGTCCCGGTCCAACGGCTCGCAGCCGGTCGAGGCGAGGCCGG
GCGGCAGCCGGCAGCGCGCCGAGCCGGACACGATGGGCGAGCCGAGTCCGAGCCCGCCGGCCCGCGTCTACTACA
GCAAGCCCGACCCGGCCGAGGTCCCGGCGGCCCCGGGCCCGGGCCCGCCGCCGCCGCTGCGGGACGACGGCTGCG
ACGACGGCCTTGTGGAGCTGTGGAGCAGGCAGAGGCAGCAGATGGCCGACAACCGGAGACACGGCCGGATCTTCG
AGCTCGCGCCGCACGCCATATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail