Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8472
Gene name
LocationContig_556:7089..9777
Strand+
Gene length (bp)2688
Transcript length (bp)2688
Coding sequence length (bp)2688
Protein length (aa) 896

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05345 He_PIG Putative Ig domain 1.6E-05 276 312

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38928|AXL2_YEAST Axial budding pattern protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AXL2 PE=1 SV=1 1 413 1.0E-34

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 461 483 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8472
MTSILASLLVLVLAQVAGGQPAISFPFNSQLPPAARVNKFFSYSLPPSTFTSDSKKITYSLGEHPGWLAIESDGR
RLYGTPTDADLPPGQVVGQTVQVIATDDKGPTTMEATLVVSRNPPPAVQIPMSKQIDSFGKFSAPSSVLFYPSTG
FEFSFDRKTFGEQQFNYYATSGDGSPLPAWVSFDAPSLTFSGKTPPFKSLIQPPQAFDFRLVASDIVGFAASSLS
FSIVVGSHKLTTDNPIISLNASWGSELVYKGLENGIQLDGKPVAPGDLDATTDRLPKWLSYDSRTARLQGSPGPG
DHTTNFTISYHDPFADTLDVLVIVHVASSLFESTLDDMEARPGSYFEFDLSKHFRNPGDIDLKVTTSPQEDWLKV
DGFKLSGQVPKTAKGDFKITIRAKSKKSGLEETEVFGISFLSLDGSTASPTAATPTSTATQTPTGSHDPTAEAAE
SESGHLSTGEILLATIIPIIFITILLMLLVCYLRRRRARRTYLSNKFRTKISHPMIASPGTNDSDSTMHEVPRAG
AAAHTKAKHFGPGPVGYAEVLSQSSRRRSSQTLGGSSVADRPRPLLEDARTVTIRSVGSSDSDSERQSWVTVEGD
DAGMAARNQDVARNHRSDTTSFADSTHQVLPTPDFFSEARNGPFRSGLDTAIPTMEDLPSVQPSPVHVYRPQHGH
YRPRQSLGAQSNTTSSSTALPPIFAGGFRSHTRNDASVSNWETIAESEAGDSIAELRRPDRALISSRPDESRQWY
DTDSSNGSKSLGTDPSFGSSENWRVIGPRGGPSTVYRDMVDEAPFHPSRPGTRQGIGGDGGGGAARHESPEPMSP
SKWADDVDTTTMSHLRPSASATSVRSRDDEQVKMSGARNGGGKTATTPAWIRDRSGQPTSDGSGSFKVFL*
Coding >Hirsu2|8472
ATGACCTCGATCTTGGCTTCGCTCTTGGTCTTGGTTCTCGCTCAGGTGGCCGGCGGCCAGCCCGCGATATCGTTC
CCCTTCAACTCGCAGCTGCCGCCCGCGGCCCGCGTCAACAAGTTCTTCTCCTACTCGTTGCCGCCGTCGACCTTT
ACGTCCGACTCGAAGAAGATAACGTACTCGCTCGGCGAACACCCCGGCTGGCTGGCCATCGAGAGCGATGGGCGC
CGCTTGTATGGCACCCCGACCGACGCCGACCTGCCGCCGGGCCAAGTCGTCGGCCAGACGGTCCAAGTCATCGCC
ACCGACGACAAGGGGCCGACGACGATGGAGGCCACCCTCGTCGTTTCTCGGAATCCTCCGCCCGCCGTCCAGATC
CCCATGTCGAAGCAAATCGACAGCTTTGGCAAATTCTCCGCCCCTTCCTCCGTCCTCTTCTATCCCTCCACCGGC
TTCGAGTTCTCGTTCGATCGAAAGACGTTTGGGGAGCAGCAGTTCAACTACTACGCCACCTCGGGCGACGGCAGC
CCTCTGCCCGCCTGGGTTTCGTTCGACGCCCCGTCGCTGACCTTCTCGGGCAAGACGCCCCCTTTCAAGTCGCTC
ATCCAGCCCCCGCAGGCCTTCGATTTCCGACTCGTCGCCTCCGATATTGTCGGCTTCGCCGCCTCATCTCTCTCC
TTCTCCATCGTCGTCGGCAGCCACAAGCTGACGACGGACAACCCCATCATCTCGCTCAACGCCAGCTGGGGGTCC
GAGCTGGTATACAAGGGCCTGGAGAATGGGATCCAACTCGACGGCAAACCGGTCGCGCCCGGCGATCTGGACGCC
ACCACTGATCGCCTTCCCAAGTGGCTGTCTTACGACAGTCGCACCGCCCGCCTCCAGGGATCGCCCGGCCCGGGA
GACCACACGACCAACTTCACCATTAGCTATCACGATCCATTTGCCGACACGCTCGACGTCCTTGTCATCGTTCAC
GTCGCGTCCAGCCTGTTCGAGTCGACGCTGGACGACATGGAAGCACGCCCGGGGAGCTACTTCGAGTTCGATCTG
TCCAAACACTTCCGGAACCCGGGCGACATTGATTTGAAGGTGACGACTAGCCCTCAGGAGGACTGGCTCAAGGTC
GATGGCTTCAAGCTGTCCGGCCAGGTTCCGAAGACGGCCAAGGGCGACTTCAAGATCACCATCCGTGCCAAGTCG
AAGAAGTCGGGGCTCGAGGAGACGGAGGTCTTCGGCATCAGCTTCTTGTCTCTCGACGGCTCCACCGCATCGCCC
ACGGCGGCCACCCCGACCTCGACCGCGACGCAGACCCCGACGGGCTCGCACGACCCAACGGCCGAGGCTGCCGAG
TCCGAGTCGGGCCATCTCAGCACAGGCGAGATCCTCCTTGCGACCATCATTCCCATCATATTCATCACCATTCTC
CTTATGCTACTCGTATGCTACCTGCGCCGCCGACGCGCGCGGCGCACCTACCTGTCCAACAAGTTCCGGACCAAG
ATTTCGCACCCCATGATTGCGAGCCCCGGTACCAACGACTCGGATTCTACGATGCACGAGGTACCTAGGGCCGGG
GCAGCGGCGCACACGAAGGCGAAGCATTTCGGGCCGGGACCGGTGGGCTATGCCGAGGTCCTTTCACAGTCGTCG
AGGCGGCGTTCCTCCCAGACACTTGGCGGCTCTTCCGTTGCGGACCGTCCGCGGCCGCTGCTCGAGGACGCGAGG
ACGGTGACGATCAGAAGCGTCGGCAGCTCAGACTCTGATTCGGAGAGGCAGTCGTGGGTTACGGTCGAGGGCGAC
GACGCCGGAATGGCGGCGAGAAACCAAGACGTGGCGCGCAACCACCGGTCCGACACGACATCGTTTGCGGATTCG
ACGCACCAGGTGCTGCCCACGCCCGATTTCTTCTCGGAAGCCAGGAACGGTCCGTTCAGGTCTGGCTTGGACACG
GCGATACCGACAATGGAGGATCTTCCGAGCGTGCAGCCGTCGCCAGTCCACGTCTACAGACCACAGCACGGCCAC
TACCGACCACGGCAGAGCCTGGGGGCGCAATCCAACACGACATCCAGCTCGACCGCCCTCCCGCCCATCTTCGCC
GGGGGCTTTCGATCACACACGAGAAACGACGCGTCCGTGTCCAACTGGGAGACGATAGCGGAGAGCGAGGCGGGA
GACAGCATAGCGGAGCTTCGGAGGCCGGACCGGGCCCTGATCAGCTCCAGGCCGGACGAGTCGAGGCAATGGTAC
GACACGGACTCGTCCAACGGCAGCAAGAGCCTCGGCACAGACCCGTCCTTCGGATCGTCGGAGAATTGGAGAGTC
ATCGGTCCTCGAGGCGGGCCGAGCACCGTGTACAGAGACATGGTCGACGAAGCGCCCTTCCACCCGTCACGGCCA
GGCACAAGGCAGGGGATAGGCGGGGACGGCGGCGGCGGGGCGGCCCGTCACGAGAGCCCCGAGCCCATGTCGCCC
AGCAAGTGGGCGGACGACGTCGACACGACGACCATGAGCCATCTGAGGCCCTCGGCCAGCGCCACGTCGGTGCGA
AGCCGCGACGACGAGCAGGTCAAGATGTCGGGGGCCCGGAACGGCGGCGGCAAGACGGCGACGACGCCGGCGTGG
ATACGGGACCGGTCGGGGCAGCCGACGTCGGACGGGAGCGGGAGCTTCAAGGTTTTTCTGTGA
Transcript >Hirsu2|8472
ATGACCTCGATCTTGGCTTCGCTCTTGGTCTTGGTTCTCGCTCAGGTGGCCGGCGGCCAGCCCGCGATATCGTTC
CCCTTCAACTCGCAGCTGCCGCCCGCGGCCCGCGTCAACAAGTTCTTCTCCTACTCGTTGCCGCCGTCGACCTTT
ACGTCCGACTCGAAGAAGATAACGTACTCGCTCGGCGAACACCCCGGCTGGCTGGCCATCGAGAGCGATGGGCGC
CGCTTGTATGGCACCCCGACCGACGCCGACCTGCCGCCGGGCCAAGTCGTCGGCCAGACGGTCCAAGTCATCGCC
ACCGACGACAAGGGGCCGACGACGATGGAGGCCACCCTCGTCGTTTCTCGGAATCCTCCGCCCGCCGTCCAGATC
CCCATGTCGAAGCAAATCGACAGCTTTGGCAAATTCTCCGCCCCTTCCTCCGTCCTCTTCTATCCCTCCACCGGC
TTCGAGTTCTCGTTCGATCGAAAGACGTTTGGGGAGCAGCAGTTCAACTACTACGCCACCTCGGGCGACGGCAGC
CCTCTGCCCGCCTGGGTTTCGTTCGACGCCCCGTCGCTGACCTTCTCGGGCAAGACGCCCCCTTTCAAGTCGCTC
ATCCAGCCCCCGCAGGCCTTCGATTTCCGACTCGTCGCCTCCGATATTGTCGGCTTCGCCGCCTCATCTCTCTCC
TTCTCCATCGTCGTCGGCAGCCACAAGCTGACGACGGACAACCCCATCATCTCGCTCAACGCCAGCTGGGGGTCC
GAGCTGGTATACAAGGGCCTGGAGAATGGGATCCAACTCGACGGCAAACCGGTCGCGCCCGGCGATCTGGACGCC
ACCACTGATCGCCTTCCCAAGTGGCTGTCTTACGACAGTCGCACCGCCCGCCTCCAGGGATCGCCCGGCCCGGGA
GACCACACGACCAACTTCACCATTAGCTATCACGATCCATTTGCCGACACGCTCGACGTCCTTGTCATCGTTCAC
GTCGCGTCCAGCCTGTTCGAGTCGACGCTGGACGACATGGAAGCACGCCCGGGGAGCTACTTCGAGTTCGATCTG
TCCAAACACTTCCGGAACCCGGGCGACATTGATTTGAAGGTGACGACTAGCCCTCAGGAGGACTGGCTCAAGGTC
GATGGCTTCAAGCTGTCCGGCCAGGTTCCGAAGACGGCCAAGGGCGACTTCAAGATCACCATCCGTGCCAAGTCG
AAGAAGTCGGGGCTCGAGGAGACGGAGGTCTTCGGCATCAGCTTCTTGTCTCTCGACGGCTCCACCGCATCGCCC
ACGGCGGCCACCCCGACCTCGACCGCGACGCAGACCCCGACGGGCTCGCACGACCCAACGGCCGAGGCTGCCGAG
TCCGAGTCGGGCCATCTCAGCACAGGCGAGATCCTCCTTGCGACCATCATTCCCATCATATTCATCACCATTCTC
CTTATGCTACTCGTATGCTACCTGCGCCGCCGACGCGCGCGGCGCACCTACCTGTCCAACAAGTTCCGGACCAAG
ATTTCGCACCCCATGATTGCGAGCCCCGGTACCAACGACTCGGATTCTACGATGCACGAGGTACCTAGGGCCGGG
GCAGCGGCGCACACGAAGGCGAAGCATTTCGGGCCGGGACCGGTGGGCTATGCCGAGGTCCTTTCACAGTCGTCG
AGGCGGCGTTCCTCCCAGACACTTGGCGGCTCTTCCGTTGCGGACCGTCCGCGGCCGCTGCTCGAGGACGCGAGG
ACGGTGACGATCAGAAGCGTCGGCAGCTCAGACTCTGATTCGGAGAGGCAGTCGTGGGTTACGGTCGAGGGCGAC
GACGCCGGAATGGCGGCGAGAAACCAAGACGTGGCGCGCAACCACCGGTCCGACACGACATCGTTTGCGGATTCG
ACGCACCAGGTGCTGCCCACGCCCGATTTCTTCTCGGAAGCCAGGAACGGTCCGTTCAGGTCTGGCTTGGACACG
GCGATACCGACAATGGAGGATCTTCCGAGCGTGCAGCCGTCGCCAGTCCACGTCTACAGACCACAGCACGGCCAC
TACCGACCACGGCAGAGCCTGGGGGCGCAATCCAACACGACATCCAGCTCGACCGCCCTCCCGCCCATCTTCGCC
GGGGGCTTTCGATCACACACGAGAAACGACGCGTCCGTGTCCAACTGGGAGACGATAGCGGAGAGCGAGGCGGGA
GACAGCATAGCGGAGCTTCGGAGGCCGGACCGGGCCCTGATCAGCTCCAGGCCGGACGAGTCGAGGCAATGGTAC
GACACGGACTCGTCCAACGGCAGCAAGAGCCTCGGCACAGACCCGTCCTTCGGATCGTCGGAGAATTGGAGAGTC
ATCGGTCCTCGAGGCGGGCCGAGCACCGTGTACAGAGACATGGTCGACGAAGCGCCCTTCCACCCGTCACGGCCA
GGCACAAGGCAGGGGATAGGCGGGGACGGCGGCGGCGGGGCGGCCCGTCACGAGAGCCCCGAGCCCATGTCGCCC
AGCAAGTGGGCGGACGACGTCGACACGACGACCATGAGCCATCTGAGGCCCTCGGCCAGCGCCACGTCGGTGCGA
AGCCGCGACGACGAGCAGGTCAAGATGTCGGGGGCCCGGAACGGCGGCGGCAAGACGGCGACGACGCCGGCGTGG
ATACGGGACCGGTCGGGGCAGCCGACGTCGGACGGGAGCGGGAGCTTCAAGGTTTTTCTGTGA
Gene >Hirsu2|8472
ATGACCTCGATCTTGGCTTCGCTCTTGGTCTTGGTTCTCGCTCAGGTGGCCGGCGGCCAGCCCGCGATATCGTTC
CCCTTCAACTCGCAGCTGCCGCCCGCGGCCCGCGTCAACAAGTTCTTCTCCTACTCGTTGCCGCCGTCGACCTTT
ACGTCCGACTCGAAGAAGATAACGTACTCGCTCGGCGAACACCCCGGCTGGCTGGCCATCGAGAGCGATGGGCGC
CGCTTGTATGGCACCCCGACCGACGCCGACCTGCCGCCGGGCCAAGTCGTCGGCCAGACGGTCCAAGTCATCGCC
ACCGACGACAAGGGGCCGACGACGATGGAGGCCACCCTCGTCGTTTCTCGGAATCCTCCGCCCGCCGTCCAGATC
CCCATGTCGAAGCAAATCGACAGCTTTGGCAAATTCTCCGCCCCTTCCTCCGTCCTCTTCTATCCCTCCACCGGC
TTCGAGTTCTCGTTCGATCGAAAGACGTTTGGGGAGCAGCAGTTCAACTACTACGCCACCTCGGGCGACGGCAGC
CCTCTGCCCGCCTGGGTTTCGTTCGACGCCCCGTCGCTGACCTTCTCGGGCAAGACGCCCCCTTTCAAGTCGCTC
ATCCAGCCCCCGCAGGCCTTCGATTTCCGACTCGTCGCCTCCGATATTGTCGGCTTCGCCGCCTCATCTCTCTCC
TTCTCCATCGTCGTCGGCAGCCACAAGCTGACGACGGACAACCCCATCATCTCGCTCAACGCCAGCTGGGGGTCC
GAGCTGGTATACAAGGGCCTGGAGAATGGGATCCAACTCGACGGCAAACCGGTCGCGCCCGGCGATCTGGACGCC
ACCACTGATCGCCTTCCCAAGTGGCTGTCTTACGACAGTCGCACCGCCCGCCTCCAGGGATCGCCCGGCCCGGGA
GACCACACGACCAACTTCACCATTAGCTATCACGATCCATTTGCCGACACGCTCGACGTCCTTGTCATCGTTCAC
GTCGCGTCCAGCCTGTTCGAGTCGACGCTGGACGACATGGAAGCACGCCCGGGGAGCTACTTCGAGTTCGATCTG
TCCAAACACTTCCGGAACCCGGGCGACATTGATTTGAAGGTGACGACTAGCCCTCAGGAGGACTGGCTCAAGGTC
GATGGCTTCAAGCTGTCCGGCCAGGTTCCGAAGACGGCCAAGGGCGACTTCAAGATCACCATCCGTGCCAAGTCG
AAGAAGTCGGGGCTCGAGGAGACGGAGGTCTTCGGCATCAGCTTCTTGTCTCTCGACGGCTCCACCGCATCGCCC
ACGGCGGCCACCCCGACCTCGACCGCGACGCAGACCCCGACGGGCTCGCACGACCCAACGGCCGAGGCTGCCGAG
TCCGAGTCGGGCCATCTCAGCACAGGCGAGATCCTCCTTGCGACCATCATTCCCATCATATTCATCACCATTCTC
CTTATGCTACTCGTATGCTACCTGCGCCGCCGACGCGCGCGGCGCACCTACCTGTCCAACAAGTTCCGGACCAAG
ATTTCGCACCCCATGATTGCGAGCCCCGGTACCAACGACTCGGATTCTACGATGCACGAGGTACCTAGGGCCGGG
GCAGCGGCGCACACGAAGGCGAAGCATTTCGGGCCGGGACCGGTGGGCTATGCCGAGGTCCTTTCACAGTCGTCG
AGGCGGCGTTCCTCCCAGACACTTGGCGGCTCTTCCGTTGCGGACCGTCCGCGGCCGCTGCTCGAGGACGCGAGG
ACGGTGACGATCAGAAGCGTCGGCAGCTCAGACTCTGATTCGGAGAGGCAGTCGTGGGTTACGGTCGAGGGCGAC
GACGCCGGAATGGCGGCGAGAAACCAAGACGTGGCGCGCAACCACCGGTCCGACACGACATCGTTTGCGGATTCG
ACGCACCAGGTGCTGCCCACGCCCGATTTCTTCTCGGAAGCCAGGAACGGTCCGTTCAGGTCTGGCTTGGACACG
GCGATACCGACAATGGAGGATCTTCCGAGCGTGCAGCCGTCGCCAGTCCACGTCTACAGACCACAGCACGGCCAC
TACCGACCACGGCAGAGCCTGGGGGCGCAATCCAACACGACATCCAGCTCGACCGCCCTCCCGCCCATCTTCGCC
GGGGGCTTTCGATCACACACGAGAAACGACGCGTCCGTGTCCAACTGGGAGACGATAGCGGAGAGCGAGGCGGGA
GACAGCATAGCGGAGCTTCGGAGGCCGGACCGGGCCCTGATCAGCTCCAGGCCGGACGAGTCGAGGCAATGGTAC
GACACGGACTCGTCCAACGGCAGCAAGAGCCTCGGCACAGACCCGTCCTTCGGATCGTCGGAGAATTGGAGAGTC
ATCGGTCCTCGAGGCGGGCCGAGCACCGTGTACAGAGACATGGTCGACGAAGCGCCCTTCCACCCGTCACGGCCA
GGCACAAGGCAGGGGATAGGCGGGGACGGCGGCGGCGGGGCGGCCCGTCACGAGAGCCCCGAGCCCATGTCGCCC
AGCAAGTGGGCGGACGACGTCGACACGACGACCATGAGCCATCTGAGGCCCTCGGCCAGCGCCACGTCGGTGCGA
AGCCGCGACGACGAGCAGGTCAAGATGTCGGGGGCCCGGAACGGCGGCGGCAAGACGGCGACGACGCCGGCGTGG
ATACGGGACCGGTCGGGGCAGCCGACGTCGGACGGGAGCGGGAGCTTCAAGGTTTTTCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail