Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8471
Gene name
LocationContig_556:3567..5155
Strand-
Gene length (bp)1588
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 3.9E-42 47 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53970|EFM6_YEAST Protein-lysine N-methyltransferase EFM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM6 PE=1 SV=1 24 238 5.0E-29
sp|A4IGU3|MT21A_XENTR Protein N-lysine methyltransferase METTL21A OS=Xenopus tropicalis GN=mettl21a PE=2 SV=1 57 228 7.0E-16
sp|Q9H867|MT21D_HUMAN Protein-lysine methyltransferase METTL21D OS=Homo sapiens GN=VCPKMT PE=1 SV=2 48 197 2.0E-14
sp|Q8C436|MT21D_MOUSE Protein-lysine methyltransferase METTL21D OS=Mus musculus GN=Vcpkmt PE=2 SV=2 57 238 9.0E-14
sp|Q96AZ1|MT21B_HUMAN Protein-lysine methyltransferase METTL21B OS=Homo sapiens GN=METTL21B PE=1 SV=1 55 198 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53970|EFM6_YEAST Protein-lysine N-methyltransferase EFM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM6 PE=1 SV=1 24 238 5.0E-29
sp|A4IGU3|MT21A_XENTR Protein N-lysine methyltransferase METTL21A OS=Xenopus tropicalis GN=mettl21a PE=2 SV=1 57 228 7.0E-16
sp|Q9H867|MT21D_HUMAN Protein-lysine methyltransferase METTL21D OS=Homo sapiens GN=VCPKMT PE=1 SV=2 48 197 2.0E-14
sp|Q8C436|MT21D_MOUSE Protein-lysine methyltransferase METTL21D OS=Mus musculus GN=Vcpkmt PE=2 SV=2 57 238 9.0E-14
sp|Q96AZ1|MT21B_HUMAN Protein-lysine methyltransferase METTL21B OS=Homo sapiens GN=METTL21B PE=1 SV=1 55 198 1.0E-13
sp|A4FV98|MT21B_BOVIN Protein-lysine methyltransferase METTL21B OS=Bos taurus GN=METTL21B PE=2 SV=1 55 197 1.0E-13
sp|Q5BLD8|MT21A_DANRE Protein N-lysine methyltransferase METTL21A OS=Danio rerio GN=mettl21a PE=2 SV=1 80 224 4.0E-13
sp|A7IQW5|MT21_CAEEL Protein-lysine methyltransferase C42C1.13 OS=Caenorhabditis elegans GN=C42C1.13 PE=3 SV=1 37 180 4.0E-12
sp|Q8WXB1|MT21A_HUMAN Protein N-lysine methyltransferase METTL21A OS=Homo sapiens GN=METTL21A PE=1 SV=2 35 224 7.0E-12
sp|Q28IN4|MT21B_XENTR Protein-lysine methyltransferase METTL21B OS=Xenopus tropicalis GN=mettl21b PE=2 SV=1 51 206 1.0E-11
sp|A4FV42|MT21A_BOVIN Protein N-lysine methyltransferase METTL21A OS=Bos taurus GN=METTL21A PE=2 SV=1 80 224 8.0E-11
sp|Q8CDZ2|MT21E_MOUSE Protein-lysine methyltransferase METTL21E OS=Mus musculus GN=Mettl21e PE=2 SV=1 59 217 1.0E-10
sp|Q9CQL0|MT21A_MOUSE Protein N-lysine methyltransferase METTL21A OS=Mus musculus GN=Mettl21A PE=2 SV=1 80 224 2.0E-10
sp|Q6DJF8|MET23_XENLA Methyltransferase-like protein 23 OS=Xenopus laevis GN=mettl23 PE=2 SV=1 59 197 1.0E-08
sp|O14118|EFM3_SCHPO Protein-lysine N-methyltransferase efm3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.03 PE=3 SV=3 25 225 1.0E-08
sp|Q86XA0|MET23_HUMAN Methyltransferase-like protein 23 OS=Homo sapiens GN=METTL23 PE=1 SV=3 62 211 2.0E-08
sp|A2AA28|MET23_MOUSE Methyltransferase-like protein 23 OS=Mus musculus GN=Mettl23 PE=2 SV=1 48 197 7.0E-08
sp|A6QP81|MT21C_BOVIN Protein-lysine methyltransferase METTL21C OS=Bos taurus GN=METTL21C PE=2 SV=1 59 212 3.0E-07
sp|Q5RJL2|MET23_RAT Methyltransferase-like protein 23 OS=Rattus norvegicus GN=Mettl23 PE=2 SV=1 48 197 5.0E-07
sp|Q5VZV1|MT21C_HUMAN Protein-lysine methyltransferase METTL21C OS=Homo sapiens GN=METTL21C PE=1 SV=1 59 212 9.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8471
MNGQAPISRSPSPPLDPVVVSEELTPLPSLKQAGIATIDFDGQLDRPLRYHEDVRTGCGGQTWPAGLVLAKNMLR
YHRRELQGARILELGAGGGLVGLAVALGCSSQGGSLLLTDQDEMLGLMQRNIRLNQVESRANALVLNWGEALPEP
VVQQRPNVILAAECVYFEPAFPLLLQTLEDLLALNDQAIVYFCFKKRRRADMQFVKMAKKALRVEELWDEDRPVF
QRQSLYLFSLRAKSAAKGDGSRTDRRDGEGGGRDSNRGSNGHDDDDDDDDIIINNGGGGGGSSSSSNGR*
Coding >Hirsu2|8471
ATGAACGGCCAAGCCCCGATCAGCCGGTCACCGTCGCCTCCGCTCGACCCCGTCGTCGTCAGCGAGGAGCTGACG
CCGCTGCCGAGCCTGAAACAGGCCGGCATCGCCACAATCGACTTCGACGGACAGCTCGACCGGCCGCTGAGGTAC
CACGAGGACGTGCGGACCGGCTGCGGCGGACAGACGTGGCCGGCCGGCCTGGTTCTGGCCAAGAACATGCTGCGA
TATCATCGACGAGAGCTCCAAGGGGCCAGAATATTGGAGCTCGGCGCAGGCGGTGGCTTGGTTGGGCTGGCTGTG
GCGCTGGGGTGCAGCAGCCAAGGGGGCTCACTGCTGCTCACGGACCAAGACGAGATGCTGGGGCTGATGCAACGC
AACATCCGGCTCAATCAGGTCGAGTCGAGAGCCAATGCCCTGGTGCTCAACTGGGGCGAGGCGCTGCCAGAGCCG
GTCGTGCAACAGCGGCCCAACGTGATTCTGGCGGCCGAGTGCGTCTACTTCGAGCCGGCCTTTCCGCTGCTCTTG
CAAACGCTCGAGGACCTGCTGGCCCTCAACGACCAGGCCATCGTCTACTTCTGCTTCAAGAAGCGCAGGCGCGCC
GACATGCAGTTTGTCAAGATGGCCAAGAAGGCCTTGAGGGTGGAGGAGCTATGGGACGAGGACCGGCCGGTGTTT
CAGCGGCAGTCGCTCTACCTGTTCAGCTTGAGGGCCAAGTCTGCAGCCAAGGGCGACGGGAGTCGCACAGACCGG
CGCGATGGTGAAGGTGGCGGCCGCGACAGCAACAGGGGCAGCAACGGCCACGACGACGACGACGACGACGACGAC
ATCATCATCAACAACGGCGGCGGCGGCGGCGGCAGCAGCAGCAGCAGCAATGGCAGGTGA
Transcript >Hirsu2|8471
ATGAACGGCCAAGCCCCGATCAGCCGGTCACCGTCGCCTCCGCTCGACCCCGTCGTCGTCAGCGAGGAGCTGACG
CCGCTGCCGAGCCTGAAACAGGCCGGCATCGCCACAATCGACTTCGACGGACAGCTCGACCGGCCGCTGAGGTAC
CACGAGGACGTGCGGACCGGCTGCGGCGGACAGACGTGGCCGGCCGGCCTGGTTCTGGCCAAGAACATGCTGCGA
TATCATCGACGAGAGCTCCAAGGGGCCAGAATATTGGAGCTCGGCGCAGGCGGTGGCTTGGTTGGGCTGGCTGTG
GCGCTGGGGTGCAGCAGCCAAGGGGGCTCACTGCTGCTCACGGACCAAGACGAGATGCTGGGGCTGATGCAACGC
AACATCCGGCTCAATCAGGTCGAGTCGAGAGCCAATGCCCTGGTGCTCAACTGGGGCGAGGCGCTGCCAGAGCCG
GTCGTGCAACAGCGGCCCAACGTGATTCTGGCGGCCGAGTGCGTCTACTTCGAGCCGGCCTTTCCGCTGCTCTTG
CAAACGCTCGAGGACCTGCTGGCCCTCAACGACCAGGCCATCGTCTACTTCTGCTTCAAGAAGCGCAGGCGCGCC
GACATGCAGTTTGTCAAGATGGCCAAGAAGGCCTTGAGGGTGGAGGAGCTATGGGACGAGGACCGGCCGGTGTTT
CAGCGGCAGTCGCTCTACCTGTTCAGCTTGAGGGCCAAGTCTGCAGCCAAGGGCGACGGGAGTCGCACAGACCGG
CGCGATGGTGAAGGTGGCGGCCGCGACAGCAACAGGGGCAGCAACGGCCACGACGACGACGACGACGACGACGAC
ATCATCATCAACAACGGCGGCGGCGGCGGCGGCAGCAGCAGCAGCAGCAATGGCAGGTGA
Gene >Hirsu2|8471
ATGAACGGCCAAGCCCCGATCAGCCGGTCACCGTCGCCTCCGCTCGACCCCGTCGTCGTCAGCGAGGAGCTGACG
CCGCTGCCGAGCCTGAAACAGGCCGGCATCGCCACAATCGACTTCGACGGACAGCTCGACCGGCCGCTGAGGTAC
CACGAGGACGTGCGGACCGGCTGCGGCGGACAGACGTGGCCGGCCGGCCTGGTTCTGGCCAAGAACATGCTGCGA
TATCATCGACGAGAGCTCCAAGGGGCCAGAATGTGCGTGGCAGACGCGTTTGCTCTCCTCCCGTTTCCCCGCCGC
CCCAACGACTCTTTTCTGTGCCTTTGTTCTTTCCGCGCCTGTTCTTTTCTTTTCCTTTCTTTCAAAAAAAAAATC
TATTTGGCTTCTTTTTTTTCTTTTGTTCTCTCTTGCGAGTATGACGAGTCTCTCCTCAGGACCTGTAGAGTCCAA
GCTGCGGCGTTCGCCGTCGCTACCGAGCGACTCCCCCCTTTCCCATCTCATCACCTCTCGTGTCTGCCCGTGCGT
GGCTGCCTTCTCCACAAAGCTCGTCTGTCGTGAAACACAGAGAAGCAAGGAAAGTCAAGGAGCCCAACAACGGAG
ACGAGGATACGAGCCAGAGGGCTGCCTCCTGAACAAAGTTGAAAGCAACAGAAGTCCGTTTGCTGACTCAAAGAT
GGCAACCCACCCCCTCGCAGATTGGAGCTCGGCGCAGGCGGTGGCTTGGTTGGGCTGGCTGTGGCGCTGGGGTGC
AGCAGCCAAGGGGGCTCACTGCTGCTCACGGACCAAGACGAGATGCTGGGGCTGATGCAACGCAACATCCGGCTC
AATCAGGTCGAGTCGAGAGCCAATGCCCTGGTGCTCAACTGGTACGTTACCCGGCTCTCCTATTCGTCTGCTGGC
CGTTTCCGCGCCGATATCCGGCCTCGCCTTGCCTTCAACACCAAGACCGGCGGGGGTGGGAGAGAGTGAGGGGGA
GAGTGAGAGGCATTGTCGACTGTCCGGCTGCTGTCTCACGATTCTCGTGTGCCGCGCACACACATACATGTGTAC
ACACAGACATACATATGTATGCGTGCGCAGATTATCATCCAAGTCGGCAGCCGATCGTCTGACGCAGTCTTGGCG
TGCTAGGGGCGAGGCGCTGCCAGAGCCGGTCGTGCAACAGCGGCCCAACGTGATTCTGGCGGCCGAGTGCGTCTA
CTTCGAGCCGGCCTTTCCGCTGCTCTTGCAAACGCTCGAGGACCTGCTGGCCCTCAACGACCAGGCCATCGTCTA
CTTCTGCTTCAAGAAGCGCAGGCGCGCCGACATGCAGTTTGTCAAGATGGCCAAGAAGGCCTTGAGGGTGGAGGA
GCTATGGGACGAGGACCGGCCGGTGTTTCAGCGGCAGTCGCTCTACCTGTTCAGCTTGAGGGCCAAGTCTGCAGC
CAAGGGCGACGGGAGTCGCACAGACCGGCGCGATGGTGAAGGTGGCGGCCGCGACAGCAACAGGGGCAGCAACGG
CCACGACGACGACGACGACGACGACGACATCATCATCAACAACGGCGGCGGCGGCGGCGGCAGCAGCAGCAGCAG
CAATGGCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail