Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|847
Gene name
LocationContig_1178:78..1166
Strand+
Gene length (bp)1088
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10300 DUF3808 Protein of unknown function (DUF3808) 5.8E-22 2 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H2B2|IML2_CHAGB Mitochondrial outer membrane protein IML2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=IML2 PE=3 SV=1 1 305 1.0E-74
sp|Q7SA06|IML2_NEUCR Mitochondrial outer membrane protein iml-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iml-2 PE=3 SV=1 1 305 2.0E-66
sp|A4QTI0|IML2_MAGO7 Mitochondrial outer membrane protein IML2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=IML2 PE=3 SV=1 1 305 7.0E-61
sp|Q0D1F8|IML2_ASPTN Mitochondrial outer membrane protein iml2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=iml2 PE=3 SV=1 1 289 1.0E-38
sp|Q4WT68|IML2_ASPFU Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iml2 PE=3 SV=2 1 288 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H2B2|IML2_CHAGB Mitochondrial outer membrane protein IML2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=IML2 PE=3 SV=1 1 305 1.0E-74
sp|Q7SA06|IML2_NEUCR Mitochondrial outer membrane protein iml-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iml-2 PE=3 SV=1 1 305 2.0E-66
sp|A4QTI0|IML2_MAGO7 Mitochondrial outer membrane protein IML2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=IML2 PE=3 SV=1 1 305 7.0E-61
sp|Q0D1F8|IML2_ASPTN Mitochondrial outer membrane protein iml2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=iml2 PE=3 SV=1 1 289 1.0E-38
sp|Q4WT68|IML2_ASPFU Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iml2 PE=3 SV=2 1 288 2.0E-36
sp|A2QQE8|IML2_ASPNC Mitochondrial outer membrane protein iml2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=iml2 PE=3 SV=1 1 288 3.0E-36
sp|B0XQF6|IML2_ASPFC Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=iml2 PE=3 SV=1 1 288 5.0E-36
sp|A1D345|IML2_NEOFI Mitochondrial outer membrane protein iml2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=iml2 PE=3 SV=1 1 288 2.0E-35
sp|A1CQ80|IML2_ASPCL Mitochondrial outer membrane protein iml2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=iml2 PE=3 SV=1 1 289 3.0E-34
sp|A7E727|IML2_SCLS1 Mitochondrial outer membrane protein iml2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=iml2 PE=3 SV=1 1 160 1.0E-22
sp|Q6BZZ6|IML2_YARLI Mitochondrial outer membrane protein IML2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IML2 PE=3 SV=1 1 249 9.0E-17
sp|O13693|YDYE_SCHPO Uncharacterized protein C11E3.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.14 PE=2 SV=1 1 296 1.0E-12
sp|Q6CSC1|IML2_KLULA Mitochondrial outer membrane protein IML2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IML2 PE=3 SV=1 35 234 5.0E-12
sp|Q6FJV9|IML2_CANGA Mitochondrial outer membrane protein IML2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IML2 PE=3 SV=1 34 234 3.0E-11
sp|A7TST2|IML2_VANPO Mitochondrial outer membrane protein IML2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=IML2 PE=3 SV=1 1 150 2.0E-09
sp|P47031|IML2_YEAST Mitochondrial outer membrane protein IML2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IML2 PE=1 SV=1 1 147 1.0E-08
sp|A6ZPP2|IML2_YEAS7 Mitochondrial outer membrane protein IML2 OS=Saccharomyces cerevisiae (strain YJM789) GN=IML2 PE=3 SV=1 1 147 1.0E-08
sp|A5DH00|IML2_PICGU Mitochondrial outer membrane protein IML2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=IML2 PE=3 SV=2 38 206 9.0E-08
sp|A5E1Y3|IML2_LODEL Mitochondrial outer membrane protein IML2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=IML2 PE=3 SV=1 95 288 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|847
MAELRVLKNFELGLLSLAVLDWPLLRDSFVASPKLAEWSPALFEYMIGCASLELYRDAFHAADDAACRRHKAEAE
ERMRSAGRVACKKRVMGRPMPIETFVQARVRRWEALAAASPGLDLADAVGVSPAVEMAYVWSAHRRMGPAELERA
VAHLAWDRCTAGPDALERLRAERDEAGTWAVNMSALLRSQGKTADARRLLEEHVVAHDRSAFKGANKMDYVLQAT
DYELAVIAWLECCRGPAAEKEEKEEGNEADEAYRRRKLDECQAGLDKAKGWESFTLEDRLGVRALFGQHTVDWMR
QKKGWERDQ*
Coding >Hirsu2|847
ATGGCCGAGCTGCGCGTGCTCAAGAACTTCGAGCTCGGCCTGCTCAGCCTCGCCGTCCTCGACTGGCCGCTGCTG
CGCGACTCCTTCGTCGCCTCGCCCAAGCTGGCCGAGTGGAGCCCGGCCCTGTTCGAGTACATGATCGGCTGCGCC
AGCCTCGAGCTGTACCGCGACGCCTTCCACGCCGCCGACGACGCCGCCTGCCGCCGCCACAAGGCCGAGGCCGAG
GAGCGCATGCGCAGCGCCGGCCGCGTCGCCTGCAAGAAGCGCGTCATGGGCCGCCCCATGCCCATCGAGACTTTC
GTCCAGGCCCGCGTCCGCCGCTGGGAGGCCCTGGCCGCCGCCTCGCCGGGCCTCGACCTGGCCGACGCCGTCGGC
GTGAGCCCGGCCGTTGAGATGGCCTACGTCTGGTCCGCCCACCGCCGCATGGGGCCGGCCGAGCTCGAGAGGGCC
GTCGCCCACCTGGCCTGGGACCGCTGCACGGCCGGCCCGGATGCGCTCGAGAGGCTGCGCGCCGAGCGCGACGAG
GCCGGCACCTGGGCCGTCAACATGTCGGCCCTGCTTCGCAGCCAGGGCAAGACGGCCGATGCCCGCCGCCTGCTC
GAGGAGCACGTCGTCGCCCACGACCGATCCGCCTTCAAGGGCGCCAACAAGATGGATTACGTGCTGCAGGCGACC
GACTACGAGCTGGCCGTCATCGCCTGGCTTGAGTGCTGCCGCGGGCCGGCGGCGGAGAAGGAGGAGAAGGAGGAG
GGCAACGAGGCGGACGAGGCGTACCGCCGCCGCAAGCTGGACGAGTGCCAGGCGGGGCTCGACAAGGCCAAGGGC
TGGGAGTCGTTCACGCTCGAGGATCGGCTCGGCGTGCGGGCGCTGTTCGGGCAGCACACGGTCGACTGGATGCGG
CAGAAGAAGGGCTGGGAGCGGGACCAGTAG
Transcript >Hirsu2|847
ATGGCCGAGCTGCGCGTGCTCAAGAACTTCGAGCTCGGCCTGCTCAGCCTCGCCGTCCTCGACTGGCCGCTGCTG
CGCGACTCCTTCGTCGCCTCGCCCAAGCTGGCCGAGTGGAGCCCGGCCCTGTTCGAGTACATGATCGGCTGCGCC
AGCCTCGAGCTGTACCGCGACGCCTTCCACGCCGCCGACGACGCCGCCTGCCGCCGCCACAAGGCCGAGGCCGAG
GAGCGCATGCGCAGCGCCGGCCGCGTCGCCTGCAAGAAGCGCGTCATGGGCCGCCCCATGCCCATCGAGACTTTC
GTCCAGGCCCGCGTCCGCCGCTGGGAGGCCCTGGCCGCCGCCTCGCCGGGCCTCGACCTGGCCGACGCCGTCGGC
GTGAGCCCGGCCGTTGAGATGGCCTACGTCTGGTCCGCCCACCGCCGCATGGGGCCGGCCGAGCTCGAGAGGGCC
GTCGCCCACCTGGCCTGGGACCGCTGCACGGCCGGCCCGGATGCGCTCGAGAGGCTGCGCGCCGAGCGCGACGAG
GCCGGCACCTGGGCCGTCAACATGTCGGCCCTGCTTCGCAGCCAGGGCAAGACGGCCGATGCCCGCCGCCTGCTC
GAGGAGCACGTCGTCGCCCACGACCGATCCGCCTTCAAGGGCGCCAACAAGATGGATTACGTGCTGCAGGCGACC
GACTACGAGCTGGCCGTCATCGCCTGGCTTGAGTGCTGCCGCGGGCCGGCGGCGGAGAAGGAGGAGAAGGAGGAG
GGCAACGAGGCGGACGAGGCGTACCGCCGCCGCAAGCTGGACGAGTGCCAGGCGGGGCTCGACAAGGCCAAGGGC
TGGGAGTCGTTCACGCTCGAGGATCGGCTCGGCGTGCGGGCGCTGTTCGGGCAGCACACGGTCGACTGGATGCGG
CAGAAGAAGGGCTGGGAGCGGGACCAGTAG
Gene >Hirsu2|847
ATGGCCGAGCTGCGCGTGCTCAAGAACTTCGAGCTCGGCCTGCTCAGCCTCGCCGTCCTCGACTGGCCGCTGCTG
CGCGACTCCTTCGTCGCCTCGCCCAAGCTGGCCGAGTGGAGCCCGGCCCTGTTCGAGTACATGATCGGCTGCGCC
AGCCTCGAGCTGTACCGCGACGCCTTCCACGCCGCCGACGACGCCGCCTGCCGCCGCCACAAGGCCGAGGCCGAG
GAGCGCATGCGCAGCGCCGGCCGCGTCGCCTGCAAGAAGCGCGTCATGGGCCGCCCCATGCCCATCGAGACTTTC
GTCCAGGCCCGCGTCCGCCGCTGGGAGGCCCTGGCCGCCGCCTCGCCGGGCCTCGACCTGGCCGACGCCGTCGGC
GTGAGCCCGGCCGTTGAGATGGCCTACGTCTGGTCCGCCCACCGCCGCATGGGGCCGGCCGAGCTCGAGAGGGCC
GTCGCCCACCTGGCCTGGGACCGCTGCACGGCCGGCCCGGATGCGCTCGAGAGGCTGCGCGCCGAGCGCGACGAG
GCCGGCACCTGGGCCGTCAACATGTCGGCCCTGCTTCGCAGCCAGGGCAAGACGGCCGATGCCCGCCGCCTGCTC
GAGGAGCACGTCGTCGCCCACGACCGGTACGTTTTTGCCCTTTTTGTTTTACTTGTCCTCCTCCCATTTCTTCCT
CACCCAAACTTGTCTTCATCTTCCTCGTCTGCCTCTTCCCCATTCTCTTCTCAAGGAGTGCACAAGTGCCCGGCT
CCCCGAGACCGTTTGCTGATCGACCTCGGCTCAGATCCGCCTTCAAGGGCGCCAACAAGATGGATTACGTGCTGC
AGGCGACCGACTACGAGCTGGCCGTCATCGCCTGGCTTGAGTGCTGCCGCGGGCCGGCGGCGGAGAAGGAGGAGA
AGGAGGAGGGCAACGAGGCGGACGAGGCGTACCGCCGCCGCAAGCTGGACGAGTGCCAGGCGGGGCTCGACAAGG
CCAAGGGCTGGGAGTCGTTCACGCTCGAGGATCGGCTCGGCGTGCGGGCGCTGTTCGGGCAGCACACGGTCGACT
GGATGCGGCAGAAGAAGGGCTGGGAGCGGGACCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail