Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8449
Gene name
LocationContig_551:10301..11542
Strand-
Gene length (bp)1241
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 4.7E-31 38 244
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.1E-24 44 269
PF08659 KR KR domain 6.9E-12 39 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZR2|TSC10_NEUCR 3-ketodihydrosphingosine reductase gsl-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gsl-3 PE=3 SV=3 2 344 6.0E-125
sp|Q5BE65|TSC10_EMENI 3-ketodihydrosphingosine reductase tsc10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tsc10 PE=3 SV=2 31 339 2.0E-95
sp|Q9Y7P2|YCKF_SCHPO Uncharacterized protein C1450.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.15 PE=3 SV=2 25 336 9.0E-46
sp|Q6BQK1|TSC10_DEBHA 3-ketodihydrosphingosine reductase TSC10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TSC10 PE=3 SV=2 27 334 2.0E-43
sp|P0CR36|TSC10_CRYNJ 3-ketodihydrosphingosine reductase TSC10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TSC10 PE=3 SV=1 37 311 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZR2|TSC10_NEUCR 3-ketodihydrosphingosine reductase gsl-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gsl-3 PE=3 SV=3 2 344 6.0E-125
sp|Q5BE65|TSC10_EMENI 3-ketodihydrosphingosine reductase tsc10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tsc10 PE=3 SV=2 31 339 2.0E-95
sp|Q9Y7P2|YCKF_SCHPO Uncharacterized protein C1450.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.15 PE=3 SV=2 25 336 9.0E-46
sp|Q6BQK1|TSC10_DEBHA 3-ketodihydrosphingosine reductase TSC10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TSC10 PE=3 SV=2 27 334 2.0E-43
sp|P0CR36|TSC10_CRYNJ 3-ketodihydrosphingosine reductase TSC10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TSC10 PE=3 SV=1 37 311 4.0E-39
sp|P0CR37|TSC10_CRYNB 3-ketodihydrosphingosine reductase TSC10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TSC10 PE=3 SV=1 37 311 2.0E-38
sp|Q59RQ2|TSC10_CANAL 3-ketodihydrosphingosine reductase TSC10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSC10 PE=3 SV=1 28 295 1.0E-36
sp|Q6CE86|TSC10_YARLI 3-ketodihydrosphingosine reductase TSC10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TSC10 PE=3 SV=1 33 344 2.0E-35
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 35 281 6.0E-32
sp|Q758B6|TSC10_ASHGO 3-ketodihydrosphingosine reductase TSC10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TSC10 PE=3 SV=1 32 324 2.0E-29
sp|P38342|TSC10_YEAST 3-ketodihydrosphingosine reductase TSC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSC10 PE=1 SV=2 32 318 3.0E-28
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 32 328 3.0E-27
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 37 297 5.0E-26
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 37 297 7.0E-26
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 37 322 3.0E-25
sp|Q6CLN0|TSC10_KLULA 3-ketodihydrosphingosine reductase TSC10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TSC10 PE=3 SV=1 35 324 3.0E-24
sp|F4JZN6|TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana GN=TSC10B PE=1 SV=1 33 312 1.0E-20
sp|Q6FQ42|TSC10_CANGA 3-ketodihydrosphingosine reductase TSC10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TSC10 PE=3 SV=1 35 286 3.0E-17
sp|P16232|DHI1_RAT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Rattus norvegicus GN=Hsd11b1 PE=1 SV=2 35 287 2.0E-16
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 33 266 3.0E-16
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 35 250 4.0E-16
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 33 266 9.0E-16
sp|P50172|DHI1_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mus musculus GN=Hsd11b1 PE=1 SV=3 35 279 2.0E-15
sp|Q7M3I4|DHI1_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Oryctolagus cuniculus GN=HSD11B1 PE=1 SV=2 35 287 5.0E-15
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 37 302 6.0E-15
sp|Q6QLL4|DHI1_CAVPO Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Cavia porcellus GN=HSD11B1 PE=1 SV=3 35 287 3.0E-14
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 35 234 2.0E-13
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 35 271 2.0E-13
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 37 248 2.0E-13
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 37 248 2.0E-13
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 37 268 7.0E-13
sp|Q6PUF3|DHI1L_DANRE Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Danio rerio GN=hsd11b1l PE=2 SV=1 31 234 8.0E-13
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 37 268 8.0E-13
sp|P9WGP9|SADH_MYCTU Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sadH PE=2 SV=1 36 282 1.0E-12
sp|P9WGP8|SADH_MYCTO Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sadH PE=3 SV=1 36 282 1.0E-12
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 35 281 1.0E-12
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 35 240 1.0E-12
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 35 240 1.0E-12
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 31 277 2.0E-12
sp|P28845|DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Homo sapiens GN=HSD11B1 PE=1 SV=3 35 234 2.0E-12
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 37 283 6.0E-12
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 31 234 6.0E-12
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 35 281 1.0E-11
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 38 248 2.0E-11
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 38 248 2.0E-11
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 34 234 5.0E-11
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 34 234 5.0E-11
sp|Q6PUF4|DHI1L_CHICK Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Gallus gallus GN=HSD11B1L PE=2 SV=1 35 246 5.0E-11
sp|Q6P7J1|DHI1A_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein A OS=Xenopus laevis GN=hsd11b1l-a PE=2 SV=1 31 270 6.0E-11
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 36 237 6.0E-11
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 37 248 7.0E-11
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 31 234 2.0E-10
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 39 260 2.0E-10
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 33 248 3.0E-10
sp|Q6R0J2|DHI1_MESAU Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mesocricetus auratus GN=HSD11B1 PE=1 SV=3 35 234 5.0E-10
sp|A5DND6|MKAR_PICGU Very-long-chain 3-oxoacyl-CoA reductase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_04787 PE=3 SV=1 36 229 6.0E-10
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 35 243 6.0E-10
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 33 245 6.0E-10
sp|Q988B7|PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 37 267 6.0E-10
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 40 253 8.0E-10
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 38 234 1.0E-09
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 33 302 1.0E-09
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 35 234 1.0E-09
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 33 275 1.0E-09
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 37 294 2.0E-09
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 37 294 2.0E-09
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 33 234 2.0E-09
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 33 234 2.0E-09
sp|Q02338|BDH_HUMAN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=BDH1 PE=1 SV=3 34 236 2.0E-09
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 35 234 2.0E-09
sp|G0RNA2|LXR4_HYPJQ L-xylo-3-hexulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr4 PE=1 SV=1 34 232 2.0E-09
sp|G0RH19|LXR3_HYPJQ L-xylulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr3 PE=1 SV=1 33 252 3.0E-09
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 35 236 3.0E-09
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 35 236 3.0E-09
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 38 262 4.0E-09
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 35 271 4.0E-09
sp|Q10245|MKAR_SCHPO Very-long-chain 3-oxoacyl-CoA reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.15 PE=3 SV=1 41 217 5.0E-09
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 35 280 5.0E-09
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 34 234 5.0E-09
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 33 234 6.0E-09
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 33 234 6.0E-09
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 31 277 7.0E-09
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 34 264 7.0E-09
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 17 294 9.0E-09
sp|Q6PKH6|DR4L2_HUMAN Dehydrogenase/reductase SDR family member 4-like 2 OS=Homo sapiens GN=DHRS4L2 PE=2 SV=1 34 230 1.0E-08
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 38 275 1.0E-08
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 23 234 1.0E-08
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 38 258 1.0E-08
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 32 234 1.0E-08
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 33 266 2.0E-08
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 35 291 2.0E-08
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 33 246 2.0E-08
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 32 234 2.0E-08
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 35 266 2.0E-08
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 38 242 2.0E-08
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 38 275 3.0E-08
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 38 275 3.0E-08
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 38 275 3.0E-08
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 32 234 3.0E-08
sp|Q9RA05|LIMC_RHOER (-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1 35 242 3.0E-08
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 24 234 3.0E-08
sp|A4IGM4|DHI1L_XENTR Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Xenopus tropicalis GN=hsd11b1l PE=2 SV=1 40 234 4.0E-08
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 38 234 5.0E-08
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 38 234 5.0E-08
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 33 267 5.0E-08
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 33 267 5.0E-08
sp|P29147|BDH_RAT D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Bdh1 PE=1 SV=2 37 236 5.0E-08
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 38 234 5.0E-08
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 38 234 5.0E-08
sp|A8E5C5|DS7CA_DANRE Dehydrogenase/reductase SDR family member 7C-A OS=Danio rerio GN=dhrs7ca PE=2 SV=1 31 217 6.0E-08
sp|P50233|DHI2_RAT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Rattus norvegicus GN=Hsd11b2 PE=1 SV=1 32 234 7.0E-08
sp|Q9L9F8|NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 41 237 7.0E-08
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 33 241 7.0E-08
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 35 266 8.0E-08
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 40 251 1.0E-07
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 38 234 2.0E-07
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 38 234 2.0E-07
sp|P80365|DHI2_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Homo sapiens GN=HSD11B2 PE=1 SV=2 31 234 2.0E-07
sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 35 271 2.0E-07
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 19 266 2.0E-07
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 32 234 2.0E-07
sp|P50168|DHI2_SHEEP Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Ovis aries GN=HSD11B2 PE=2 SV=1 31 234 2.0E-07
sp|D2WKD9|SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 37 234 2.0E-07
sp|Q3T046|BDH2_BOVIN 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 35 247 3.0E-07
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 26 275 4.0E-07
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 36 234 4.0E-07
sp|D4A1J4|BDH2_RAT 3-hydroxybutyrate dehydrogenase type 2 OS=Rattus norvegicus GN=Bdh2 PE=3 SV=2 35 241 4.0E-07
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 35 281 4.0E-07
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 35 281 4.0E-07
sp|Q7SYS6|DHI1B_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein B OS=Xenopus laevis GN=hsd11b1l-b PE=2 SV=1 31 270 5.0E-07
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 35 236 6.0E-07
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 20 236 6.0E-07
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 20 236 7.0E-07
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 29 266 7.0E-07
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 38 236 7.0E-07
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 38 236 7.0E-07
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 38 237 8.0E-07
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 40 241 8.0E-07
sp|O42866|FABG_SCHPO 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oar2 PE=3 SV=1 38 248 8.0E-07
sp|O77667|DHI2_BOVIN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Bos taurus GN=HSD11B2 PE=1 SV=1 31 234 9.0E-07
sp|P37058|DHB3_HUMAN Testosterone 17-beta-dehydrogenase 3 OS=Homo sapiens GN=HSD17B3 PE=1 SV=2 37 299 1.0E-06
sp|O02691|HCD2_BOVIN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3 35 237 1.0E-06
sp|Q99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 35 237 1.0E-06
sp|P51976|DHI2_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Oryctolagus cuniculus GN=HSD11B2 PE=2 SV=1 31 234 1.0E-06
sp|P51975|DHI1_SHEEP Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Ovis aries GN=HSD11B1 PE=2 SV=3 35 234 2.0E-06
sp|Q3KPT7|BDH2_XENLA 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 35 270 2.0E-06
sp|P9WGS5|Y2750_MYCTU Uncharacterized oxidoreductase Rv2750 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2750 PE=1 SV=1 34 242 2.0E-06
sp|P9WGS4|Y2750_MYCTO Uncharacterized oxidoreductase MT2820 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2820 PE=3 SV=1 34 242 2.0E-06
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 36 237 2.0E-06
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 38 284 2.0E-06
sp|P51661|DHI2_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Mus musculus GN=Hsd11b2 PE=1 SV=2 32 234 2.0E-06
sp|P51657|DHB1_RAT Estradiol 17-beta-dehydrogenase 1 OS=Rattus norvegicus GN=Hsd17b1 PE=1 SV=1 35 234 3.0E-06
sp|P31808|YCIK_ECOLI Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 35 232 3.0E-06
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 38 274 3.0E-06
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 35 266 3.0E-06
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 37 239 4.0E-06
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 35 266 4.0E-06
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 40 241 4.0E-06
sp|Q6BIG0|MKAR_DEBHA Very-long-chain 3-oxoacyl-CoA reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G10780g PE=3 SV=1 36 293 5.0E-06
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 35 266 5.0E-06
sp|P06234|NODG_RHIME Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 37 248 6.0E-06
sp|Q6CHP1|MKAR_YARLI Very-long-chain 3-oxoacyl-CoA reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0A06787g PE=3 SV=1 41 333 7.0E-06
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 38 261 7.0E-06
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 38 261 7.0E-06
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 38 261 7.0E-06
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 38 261 7.0E-06
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 38 261 7.0E-06
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 38 261 7.0E-06
sp|O54939|DHB3_RAT Testosterone 17-beta-dehydrogenase 3 OS=Rattus norvegicus GN=Hsd17b3 PE=2 SV=1 30 271 8.0E-06
sp|Q8AVY8|DH12B_XENLA Very-long-chain 3-oxoacyl-CoA reductase-B OS=Xenopus laevis GN=hsd17b12-b PE=2 SV=1 6 104 8.0E-06
sp|P0AET8|HDHA_ECOLI 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 27 270 8.0E-06
sp|P0AET9|HDHA_ECO57 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 27 270 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8449
MDIRPAATVWIAVAALLAAAAASAMGLFGGNKMPVEGKTVLLTGASEGMGLSVARKLAARGANVILLSRSVDKLK
EAVEAVEAAAKYPNRQRFRYISADVSAPSYADAVVAEATRWNGGRVPDIVWCIAGSATPSLFVDMDMASMRSQMD
LNFFGTAEMAHAVLRRWLAPNAPVDSEPRHLVLTTSVVALYTIPGYAPYAPSKWAIRGLADTISQEVMMYPQNVK
VHVVYPGTILSPGLERENRTKPEITKLIEETDPKQTPDEVAESAIRGLERGDYYVAVNWLGNLMKWGVLGGAFRN
SWIVDTLGAWLAPIIWFFVHMDIHGKIRSYGKRHGHPSTYKRHQV*
Coding >Hirsu2|8449
ATGGACATACGGCCCGCAGCCACGGTCTGGATCGCCGTCGCAGCTCTGCTCGCCGCCGCCGCCGCCTCCGCAATG
GGTCTGTTCGGAGGCAACAAGATGCCCGTCGAGGGCAAGACGGTCCTCCTGACGGGCGCGTCCGAGGGCATGGGC
CTGTCCGTCGCCCGCAAGCTCGCAGCCCGCGGCGCCAACGTCATCCTCCTCTCCCGAAGCGTCGACAAGCTCAAG
GAAGCTGTTGAAGCCGTCGAGGCCGCAGCCAAGTACCCGAACAGGCAGCGCTTCCGCTACATCTCGGCCGACGTC
TCGGCGCCCTCGTACGCCGACGCCGTCGTGGCCGAAGCGACGCGGTGGAACGGCGGGCGGGTCCCGGACATCGTC
TGGTGCATCGCCGGCTCCGCCACGCCCTCGCTCTTCGTCGACATGGACATGGCCTCGATGCGCAGCCAGATGGAC
CTCAACTTCTTCGGCACGGCCGAGATGGCCCACGCCGTCCTCCGTCGCTGGCTCGCCCCCAACGCCCCCGTCGAC
AGCGAGCCCAGGCACCTCGTCCTGACCACCAGCGTCGTCGCCCTCTACACCATCCCCGGCTACGCCCCCTACGCC
CCCTCCAAGTGGGCCATCCGCGGCCTCGCCGACACAATCTCCCAAGAGGTCATGATGTATCCCCAGAACGTCAAG
GTCCACGTCGTCTACCCCGGCACCATCCTCTCGCCCGGGCTCGAGCGCGAGAACCGGACCAAGCCGGAAATCACC
AAGCTCATCGAGGAGACGGACCCCAAGCAGACCCCGGACGAGGTGGCCGAGAGCGCCATCCGTGGCCTGGAAAGA
GGTGACTACTACGTCGCCGTCAACTGGTTGGGAAACCTCATGAAATGGGGCGTGCTCGGAGGCGCCTTTCGAAAC
AGCTGGATCGTCGACACGCTGGGTGCCTGGCTCGCACCCATCATCTGGTTCTTTGTTCACATGGATATACATGGG
AAGATTAGGAGCTACGGCAAGAGGCACGGCCACCCCAGCACCTACAAAAGACACCAAGTATGA
Transcript >Hirsu2|8449
ATGGACATACGGCCCGCAGCCACGGTCTGGATCGCCGTCGCAGCTCTGCTCGCCGCCGCCGCCGCCTCCGCAATG
GGTCTGTTCGGAGGCAACAAGATGCCCGTCGAGGGCAAGACGGTCCTCCTGACGGGCGCGTCCGAGGGCATGGGC
CTGTCCGTCGCCCGCAAGCTCGCAGCCCGCGGCGCCAACGTCATCCTCCTCTCCCGAAGCGTCGACAAGCTCAAG
GAAGCTGTTGAAGCCGTCGAGGCCGCAGCCAAGTACCCGAACAGGCAGCGCTTCCGCTACATCTCGGCCGACGTC
TCGGCGCCCTCGTACGCCGACGCCGTCGTGGCCGAAGCGACGCGGTGGAACGGCGGGCGGGTCCCGGACATCGTC
TGGTGCATCGCCGGCTCCGCCACGCCCTCGCTCTTCGTCGACATGGACATGGCCTCGATGCGCAGCCAGATGGAC
CTCAACTTCTTCGGCACGGCCGAGATGGCCCACGCCGTCCTCCGTCGCTGGCTCGCCCCCAACGCCCCCGTCGAC
AGCGAGCCCAGGCACCTCGTCCTGACCACCAGCGTCGTCGCCCTCTACACCATCCCCGGCTACGCCCCCTACGCC
CCCTCCAAGTGGGCCATCCGCGGCCTCGCCGACACAATCTCCCAAGAGGTCATGATGTATCCCCAGAACGTCAAG
GTCCACGTCGTCTACCCCGGCACCATCCTCTCGCCCGGGCTCGAGCGCGAGAACCGGACCAAGCCGGAAATCACC
AAGCTCATCGAGGAGACGGACCCCAAGCAGACCCCGGACGAGGTGGCCGAGAGCGCCATCCGTGGCCTGGAAAGA
GGTGACTACTACGTCGCCGTCAACTGGTTGGGAAACCTCATGAAATGGGGCGTGCTCGGAGGCGCCTTTCGAAAC
AGCTGGATCGTCGACACGCTGGGTGCCTGGCTCGCACCCATCATCTGGTTCTTTGTTCACATGGATATACATGGG
AAGATTAGGAGCTACGGCAAGAGGCACGGCCACCCCAGCACCTACAAAAGACACCAAGTATGA
Gene >Hirsu2|8449
ATGGACATACGGCCCGCAGCCACGGTCTGGATCGCCGTCGCAGCTCTGCTCGCCGCCGCCGCCGCCTCCGCAATG
GGTCTGTTCGGAGGCAACAAGATGCCCGTCGAGGGCAAGGTATGTATCTAGTCGCCGACAAGACGGGCGCCGATG
CCTTTCCTCGCCGCCGTTGCACAGGGGCAAGGAAAGCTGACGCGGCGCCGCAGACGGTCCTCCTGACGGGCGCGT
CCGAGGGCATGGGCCTGTCCGTCGCCCGCAAGCTCGCAGCCCGCGGCGCCAACGTCATCCTCCTCTCCCGAAGCG
TCGACAAGCTCAAGGAAGCTGTTGAAGCCGTCGAGGTCCGTCCGTCGAATCCGCTCTCCCCTCCCGCCCTCGACC
CGTACCGTGGTCACCAGCAGCTGACTGACGTGAGCGGTTGTCCTTCTTTCCTTCTCTCTCGCCCTTCGATCCAGG
CCGCAGCCAAGTACCCGAACAGGCAGCGCTTCCGCTACATCTCGGCCGACGTCTCGGCGCCCTCGTACGCCGACG
CCGTCGTGGCCGAAGCGACGCGGTGGAACGGCGGGCGGGTCCCGGACATCGTCTGGTGCATCGCCGGCTCCGCCA
CGCCCTCGCTCTTCGTCGACATGGACATGGCCTCGATGCGCAGCCAGATGGACCTCAACTTCTTCGGCACGGCCG
AGATGGCCCACGCCGTCCTCCGTCGCTGGCTCGCCCCCAACGCCCCCGTCGACAGCGAGCCCAGGCACCTCGTCC
TGACCACCAGCGTCGTCGCCCTCTACACCATCCCCGGCTACGCCCCCTACGCCCCCTCCAAGTGGGCCATCCGCG
GCCTCGCCGACACAATCTCCCAAGAGGTCATGATGTATCCCCAGAACGTCAAGGTCCACGTCGTCTACCCCGGCA
CCATCCTCTCGCCCGGGCTCGAGCGCGAGAACCGGACCAAGCCGGAAATCACCAAGCTCATCGAGGAGACGGACC
CCAAGCAGACCCCGGACGAGGTGGCCGAGAGCGCCATCCGTGGCCTGGAAAGAGGTGACTACTACGTCGCCGTCA
ACTGGTTGGGAAACCTCATGAAATGGGGCGTGCTCGGAGGCGCCTTTCGAAACAGCTGGATCGTCGACACGCTGG
GTGCCTGGCTCGCACCCATCATCTGGTTCTTTGTTCACATGGATATACATGGGAAGATTAGGAGCTACGGCAAGA
GGCACGGCCACCCCAGCACCTACAAAAGACACCAAGTATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail