Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8429
Gene name
LocationContig_55:23069..23465
Strand-
Gene length (bp)396
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00984 UDPG_MGDP_dh UDP-glucose/GDP-mannose dehydrogenase family, central domain 1.5E-20 17 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G3XD94|UGND_PSEAE UDP-N-acetyl-D-glucosamine 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpA PE=1 SV=1 1 85 5.0E-27
sp|P67067|WECC_SHIFL UDP-N-acetyl-D-mannosamine dehydrogenase OS=Shigella flexneri GN=wecC PE=3 SV=1 12 105 3.0E-12
sp|P27829|WECC_ECOLI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli (strain K12) GN=wecC PE=1 SV=4 12 105 3.0E-12
sp|P67066|WECC_ECO57 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli O157:H7 GN=wecC PE=3 SV=1 12 105 3.0E-12
sp|Q9L6R4|WECC_SALTY UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=wecC PE=3 SV=1 12 111 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G3XD94|UGND_PSEAE UDP-N-acetyl-D-glucosamine 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpA PE=1 SV=1 1 85 5.0E-27
sp|P67067|WECC_SHIFL UDP-N-acetyl-D-mannosamine dehydrogenase OS=Shigella flexneri GN=wecC PE=3 SV=1 12 105 3.0E-12
sp|P27829|WECC_ECOLI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli (strain K12) GN=wecC PE=1 SV=4 12 105 3.0E-12
sp|P67066|WECC_ECO57 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli O157:H7 GN=wecC PE=3 SV=1 12 105 3.0E-12
sp|Q9L6R4|WECC_SALTY UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=wecC PE=3 SV=1 12 111 5.0E-12
sp|Q04972|VIPA_SALTI Vi polysaccharide biosynthesis protein VipA/TviB OS=Salmonella typhi GN=vipA PE=3 SV=1 14 85 5.0E-12
sp|Q8Z389|WECC_SALTI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhi GN=wecC PE=3 SV=1 12 111 5.0E-12
sp|P39861|CAPL_STAAU Protein CapL OS=Staphylococcus aureus GN=capL PE=3 SV=1 13 85 7.0E-12
sp|P58591|EPSD_RALSO NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=epsD PE=3 SV=1 12 111 1.0E-10
sp|Q45410|EPSD_RALSL NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum GN=epsD PE=3 SV=1 12 111 1.0E-10
sp|Q8ZAE4|WECC_YERPE UDP-N-acetyl-D-mannosamine dehydrogenase OS=Yersinia pestis GN=wecC PE=3 SV=1 12 89 2.0E-10
sp|A6VK13|WECC_METM7 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=wecC PE=3 SV=1 1 110 2.0E-10
sp|A4FY94|WECC_METM5 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=wecC PE=3 SV=1 1 110 2.0E-10
sp|Q6LZC3|WECC_METMP UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=wecC PE=1 SV=1 1 108 7.0E-10
sp|A6USK4|WECC_METVS UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=wecC PE=3 SV=1 1 105 2.0E-09
sp|Q57871|WECC_METJA UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wecC PE=3 SV=1 12 110 9.0E-09
sp|A6UU98|WECC_META3 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=wecC PE=3 SV=1 1 90 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0051287 NAD binding Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.3744 0.3207 0.3767 0.2332 0.3797 0.0267 0.0477 0.2181 0.1145 0.0146

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup484
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1871
Ophiocordyceps australis map64 (Brazil) OphauB2|7347
Ophiocordyceps camponoti-floridani Ophcf2|05776
Ophiocordyceps camponoti-rufipedis Ophun1|1148
Ophiocordyceps kimflemingae Ophio5|5242
Ophiocordyceps subramaniannii Hirsu2|10824
Ophiocordyceps subramaniannii Hirsu2|8429 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9170

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8429
LYARAFDRVVPVSSPEVAEMAKLYENCQRMVCIVYANEMADACRARGIDPFEVCAAAATKPFGYMPFRPGLGVGG
HCIPVNPYYLLANNDFPLLQAATECMRRRPAAIAQRATGSTCPRAVSVEGADASPG*
Coding >Hirsu2|8429
CTGTACGCCCGCGCCTTCGACCGCGTCGTGCCCGTGTCGAGCCCCGAGGTGGCCGAGATGGCCAAACTGTACGAG
AACTGCCAGCGCATGGTGTGCATCGTCTACGCCAACGAGATGGCCGACGCGTGTCGCGCGCGCGGCATCGACCCC
TTCGAGGTCTGCGCCGCCGCCGCGACGAAGCCCTTCGGCTACATGCCGTTCCGGCCAGGGCTGGGCGTCGGCGGC
CACTGCATCCCCGTCAACCCCTACTACCTGCTGGCCAACAACGACTTCCCGCTCCTCCAGGCGGCGACGGAATGC
ATGCGGCGCCGACCGGCCGCCATCGCCCAGAGGGCCACAGGTAGCACTTGTCCGCGTGCCGTCAGCGTCGAAGGT
GCAGATGCAAGTCCCGGCTGA
Transcript >Hirsu2|8429
CTGTACGCCCGCGCCTTCGACCGCGTCGTGCCCGTGTCGAGCCCCGAGGTGGCCGAGATGGCCAAACTGTACGAG
AACTGCCAGCGCATGGTGTGCATCGTCTACGCCAACGAGATGGCCGACGCGTGTCGCGCGCGCGGCATCGACCCC
TTCGAGGTCTGCGCCGCCGCCGCGACGAAGCCCTTCGGCTACATGCCGTTCCGGCCAGGGCTGGGCGTCGGCGGC
CACTGCATCCCCGTCAACCCCTACTACCTGCTGGCCAACAACGACTTCCCGCTCCTCCAGGCGGCGACGGAATGC
ATGCGGCGCCGACCGGCCGCCATCGCCCAGAGGGCCACAGGTAGCACTTGTCCGCGTGCCGTCAGCGTCGAAGGT
GCAGATGCAAGTCCCGGCTGA
Gene >Hirsu2|8429
CTGTACGCCCGCGCCTTCGACCGCGTCGTGCCCGTGTCGAGCCCCGAGGTGGCCGAGATGGCCAAACTGTACGAG
AACTGCCAGCGCATGGTGTGCATCGTCTACGCCAACGAGATGGCCGACGCGTGTCGCGCGCGCGGCATCGACCCC
TTCGAGGTCTGCGCCGCCGCCGCGACGAAGCCCTTCGGCTACATGCCGTTCCGGCCAGGGCTGGGCGTCGGCGGC
CACTGCATCCCCGTCAACCCCTACTACCTGCTGGCCAACAACGACTTCCCGCTCCTCCAGGCGGCGACGGAATGC
ATGCGGCGCCGACCGGCCGCCATCGCCCAGAGGGCCACAGGTAGCACTTGTCCGCGTGCCGTCAGCGTCGAAGGT
GCAGATGCAAGTCCCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail