Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8429
Gene name
LocationContig_55:23069..23465
Strand-
Gene length (bp)396
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00984 UDPG_MGDP_dh UDP-glucose/GDP-mannose dehydrogenase family, central domain 1.7E-20 17 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G3XD94|UGND_PSEAE UDP-N-acetyl-D-glucosamine 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpA PE=1 SV=1 1 85 5.0E-27
sp|P67067|WECC_SHIFL UDP-N-acetyl-D-mannosamine dehydrogenase OS=Shigella flexneri GN=wecC PE=3 SV=1 12 105 3.0E-12
sp|P27829|WECC_ECOLI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli (strain K12) GN=wecC PE=1 SV=4 12 105 3.0E-12
sp|P67066|WECC_ECO57 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli O157:H7 GN=wecC PE=3 SV=1 12 105 3.0E-12
sp|Q9L6R4|WECC_SALTY UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=wecC PE=3 SV=1 12 111 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G3XD94|UGND_PSEAE UDP-N-acetyl-D-glucosamine 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpA PE=1 SV=1 1 85 5.0E-27
sp|P67067|WECC_SHIFL UDP-N-acetyl-D-mannosamine dehydrogenase OS=Shigella flexneri GN=wecC PE=3 SV=1 12 105 3.0E-12
sp|P27829|WECC_ECOLI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli (strain K12) GN=wecC PE=1 SV=4 12 105 3.0E-12
sp|P67066|WECC_ECO57 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli O157:H7 GN=wecC PE=3 SV=1 12 105 3.0E-12
sp|Q9L6R4|WECC_SALTY UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=wecC PE=3 SV=1 12 111 5.0E-12
sp|Q04972|VIPA_SALTI Vi polysaccharide biosynthesis protein VipA/TviB OS=Salmonella typhi GN=vipA PE=3 SV=1 14 85 5.0E-12
sp|Q8Z389|WECC_SALTI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhi GN=wecC PE=3 SV=1 12 111 5.0E-12
sp|P39861|CAPL_STAAU Protein CapL OS=Staphylococcus aureus GN=capL PE=3 SV=1 13 85 7.0E-12
sp|P58591|EPSD_RALSO NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=epsD PE=3 SV=1 12 111 1.0E-10
sp|Q45410|EPSD_RALSL NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum GN=epsD PE=3 SV=1 12 111 1.0E-10
sp|Q8ZAE4|WECC_YERPE UDP-N-acetyl-D-mannosamine dehydrogenase OS=Yersinia pestis GN=wecC PE=3 SV=1 12 89 2.0E-10
sp|A6VK13|WECC_METM7 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=wecC PE=3 SV=1 1 110 2.0E-10
sp|A4FY94|WECC_METM5 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=wecC PE=3 SV=1 1 110 2.0E-10
sp|Q6LZC3|WECC_METMP UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=wecC PE=1 SV=1 1 108 7.0E-10
sp|A6USK4|WECC_METVS UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=wecC PE=3 SV=1 1 105 2.0E-09
sp|Q57871|WECC_METJA UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wecC PE=3 SV=1 12 110 9.0E-09
sp|A6UU98|WECC_META3 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=wecC PE=3 SV=1 1 90 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0097159 organic cyclic compound binding No
GO:0050662 coenzyme binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8429
LYARAFDRVVPVSSPEVAEMAKLYENCQRMVCIVYANEMADACRARGIDPFEVCAAAATKPFGYMPFRPGLGVGG
HCIPVNPYYLLANNDFPLLQAATECMRRRPAAIAQRATGSTCPRAVSVEGADASPG*
Coding >Hirsu2|8429
CTGTACGCCCGCGCCTTCGACCGCGTCGTGCCCGTGTCGAGCCCCGAGGTGGCCGAGATGGCCAAACTGTACGAG
AACTGCCAGCGCATGGTGTGCATCGTCTACGCCAACGAGATGGCCGACGCGTGTCGCGCGCGCGGCATCGACCCC
TTCGAGGTCTGCGCCGCCGCCGCGACGAAGCCCTTCGGCTACATGCCGTTCCGGCCAGGGCTGGGCGTCGGCGGC
CACTGCATCCCCGTCAACCCCTACTACCTGCTGGCCAACAACGACTTCCCGCTCCTCCAGGCGGCGACGGAATGC
ATGCGGCGCCGACCGGCCGCCATCGCCCAGAGGGCCACAGGTAGCACTTGTCCGCGTGCCGTCAGCGTCGAAGGT
GCAGATGCAAGTCCCGGCTGA
Transcript >Hirsu2|8429
CTGTACGCCCGCGCCTTCGACCGCGTCGTGCCCGTGTCGAGCCCCGAGGTGGCCGAGATGGCCAAACTGTACGAG
AACTGCCAGCGCATGGTGTGCATCGTCTACGCCAACGAGATGGCCGACGCGTGTCGCGCGCGCGGCATCGACCCC
TTCGAGGTCTGCGCCGCCGCCGCGACGAAGCCCTTCGGCTACATGCCGTTCCGGCCAGGGCTGGGCGTCGGCGGC
CACTGCATCCCCGTCAACCCCTACTACCTGCTGGCCAACAACGACTTCCCGCTCCTCCAGGCGGCGACGGAATGC
ATGCGGCGCCGACCGGCCGCCATCGCCCAGAGGGCCACAGGTAGCACTTGTCCGCGTGCCGTCAGCGTCGAAGGT
GCAGATGCAAGTCCCGGCTGA
Gene >Hirsu2|8429
CTGTACGCCCGCGCCTTCGACCGCGTCGTGCCCGTGTCGAGCCCCGAGGTGGCCGAGATGGCCAAACTGTACGAG
AACTGCCAGCGCATGGTGTGCATCGTCTACGCCAACGAGATGGCCGACGCGTGTCGCGCGCGCGGCATCGACCCC
TTCGAGGTCTGCGCCGCCGCCGCGACGAAGCCCTTCGGCTACATGCCGTTCCGGCCAGGGCTGGGCGTCGGCGGC
CACTGCATCCCCGTCAACCCCTACTACCTGCTGGCCAACAACGACTTCCCGCTCCTCCAGGCGGCGACGGAATGC
ATGCGGCGCCGACCGGCCGCCATCGCCCAGAGGGCCACAGGTAGCACTTGTCCGCGTGCCGTCAGCGTCGAAGGT
GCAGATGCAAGTCCCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail