Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8428
Gene name
LocationContig_55:17490..19986
Strand+
Gene length (bp)2496
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 1.3E-35 509 761
PF14529 Exo_endo_phos_2 Endonuclease-reverse transcriptase 2.2E-22 109 235

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03277|PO11_BRACO Retrovirus-related Pol polyprotein from type-1 retrotransposable element R1 (Fragment) OS=Bradysia coprophila PE=3 SV=1 195 831 7.0E-35
sp|Q9NBX4|RTXE_DROME Probable RNA-directed DNA polymerase from transposon X-element OS=Drosophila melanogaster GN=X-elementORF2 PE=3 SV=1 144 820 4.0E-31
sp|P21329|RTJK_DROFU RNA-directed DNA polymerase from mobile element jockey OS=Drosophila funebris GN=jockeypol PE=1 SV=1 80 772 2.0E-28
sp|Q95SX7|RTBS_DROME Probable RNA-directed DNA polymerase from transposon BS OS=Drosophila melanogaster GN=RTase PE=2 SV=1 148 831 2.0E-28
sp|P16425|Y2R2_DROME Putative 115 kDa protein in type-1 retrotransposable element R1DM OS=Drosophila melanogaster GN=R1A1-elementORF2 PE=3 SV=1 254 819 4.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03277|PO11_BRACO Retrovirus-related Pol polyprotein from type-1 retrotransposable element R1 (Fragment) OS=Bradysia coprophila PE=3 SV=1 195 831 7.0E-35
sp|Q9NBX4|RTXE_DROME Probable RNA-directed DNA polymerase from transposon X-element OS=Drosophila melanogaster GN=X-elementORF2 PE=3 SV=1 144 820 4.0E-31
sp|P21329|RTJK_DROFU RNA-directed DNA polymerase from mobile element jockey OS=Drosophila funebris GN=jockeypol PE=1 SV=1 80 772 2.0E-28
sp|Q95SX7|RTBS_DROME Probable RNA-directed DNA polymerase from transposon BS OS=Drosophila melanogaster GN=RTase PE=2 SV=1 148 831 2.0E-28
sp|P16425|Y2R2_DROME Putative 115 kDa protein in type-1 retrotransposable element R1DM OS=Drosophila melanogaster GN=R1A1-elementORF2 PE=3 SV=1 254 819 4.0E-28
sp|P21328|RTJK_DROME RNA-directed DNA polymerase from mobile element jockey OS=Drosophila melanogaster GN=pol PE=1 SV=1 133 830 7.0E-28
sp|O00370|LORF2_HUMAN LINE-1 retrotransposable element ORF2 protein OS=Homo sapiens PE=1 SV=1 409 771 2.0E-14
sp|Q03274|PO22_POPJA Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Popillia japonica PE=3 SV=1 449 668 7.0E-13
sp|P08548|LIN1_NYCCO LINE-1 reverse transcriptase homolog OS=Nycticebus coucang PE=3 SV=1 443 771 7.0E-12
sp|P14381|YTX2_XENLA Transposon TX1 uncharacterized 149 kDa protein OS=Xenopus laevis PE=3 SV=1 405 657 2.0E-11
sp|P11369|LORF2_MOUSE LINE-1 retrotransposable element ORF2 protein OS=Mus musculus GN=Pol PE=1 SV=2 446 767 1.0E-10
sp|Q03278|PO21_NASVI Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Nasonia vitripennis PE=3 SV=2 439 764 4.0E-09
sp|P16423|POLR_DROME Retrovirus-related Pol polyprotein from type-2 retrotransposable element R2DM OS=Drosophila melanogaster GN=pol PE=3 SV=1 460 728 5.0E-09
sp|Q05118|PO23_POPJA Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Popillia japonica PE=3 SV=1 569 764 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular 0.6729 0.4176 0.7829 0.085 0.2963 0.1308 0.1054 0.0547 0.2283 0.0203

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup369
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|941
Ophiocordyceps subramaniannii Hirsu2|10220
Ophiocordyceps subramaniannii Hirsu2|1656
Ophiocordyceps subramaniannii Hirsu2|552
Ophiocordyceps subramaniannii Hirsu2|7707
Ophiocordyceps subramaniannii Hirsu2|7736
Ophiocordyceps subramaniannii Hirsu2|8187
Ophiocordyceps subramaniannii Hirsu2|84
Ophiocordyceps subramaniannii Hirsu2|8425
Ophiocordyceps subramaniannii Hirsu2|8428 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8428
MMLEPFRILQLNVRKRDPVQQSLMNDADLKDFAVLAVSEPFARSIDGRVVTSPMGHINWTKMIPTCTHDASWPIR
SMLWVRNDIEAEQVPVPSADLTAAVLRLAERDVMVVSVYVEGNSSEALTVVVGLLHDLVDCFRDRTGRRTDVLLA
GDFNRHDILWGGDEVSARRQGEGQPIVDLMNEHGLCSLLPRGTKTWQGPDKESTIDLVLASSELAEETVTCAIHA
TEHGSDHRAIQTTFDMDMPQRTTMQRLLFKNAPWILIGARVKDELRPLPWTVDVQTQADQLMRVVGEAVHELTPR
AQPPPYAKRWWTKDLTRLRRTYTFWRNQARMQRRAGQSRPDLEKCAKEAAKEYHDNIRKQKKAHWDDFVAEENNI
WKAVRYLKPGRDITDDKVPPLRRADGSATEGKAEEAEELLSTFFPPLPTGINAEGERPKRSAVPMPDLTLEEIEE
KVMAAKPWKAPGEDGLPAIVWRRLWHVVKYRVWTLFDASLRDGVVPRQWRTAKIIPLKKPDKGDYALAKAWRPIS
LLSTLGKILEAVVAERISYAVETHGLLPANHFGARKRRSADQALMLLQEQIYRAWRAGKVLSLISFDVKGAYNGV
CKERLLERMKARGIPDKLVTWMDAFCSERTAAVVVNGHTSEQRILPQAGLPQGSPLSPIAFLFFNADLVQRRINA
KGGSIAFVDDYSAWVTGPTAEANREGIQSIISDLLEWEKRSGATFEADKTTVIHFTRVAERRSGTSFTIKGKEVK
PKSSVKLLGVVMDTNLRFKEHIVRAAAKGLAAAMCLRRLKMISPRMARQLFVATVAPTMDYGSIVWMQSCGMREA
VWLNRA*
Coding >Hirsu2|8428
ATGATGCTTGAGCCCTTCCGCATCCTACAGCTGAATGTGCGCAAGCGGGATCCGGTGCAGCAAAGCTTGATGAAC
GATGCAGACCTCAAGGATTTTGCCGTATTGGCAGTCTCTGAGCCGTTTGCGCGCAGCATTGATGGTAGGGTGGTG
ACGAGCCCCATGGGGCACATTAACTGGACGAAGATGATACCAACGTGCACACATGATGCGTCGTGGCCGATCCGC
AGCATGCTCTGGGTTCGGAACGACATTGAGGCGGAGCAGGTGCCGGTGCCGTCGGCCGACCTCACAGCAGCGGTG
CTTCGACTCGCGGAGAGGGACGTGATGGTGGTGTCGGTGTACGTGGAGGGCAACAGCAGCGAGGCACTGACGGTC
GTGGTAGGGCTGTTACACGATCTGGTCGATTGCTTTCGCGACAGGACAGGGAGACGCACGGATGTGTTGCTGGCG
GGAGACTTCAATCGTCACGACATACTCTGGGGCGGAGACGAGGTGTCAGCGAGAAGACAAGGGGAAGGCCAGCCC
ATTGTCGACCTGATGAACGAGCATGGTCTCTGCAGCCTTCTGCCGAGAGGGACGAAGACGTGGCAAGGGCCGGAC
AAGGAAAGCACCATTGACCTGGTGCTCGCGTCGTCAGAGCTGGCCGAGGAGACGGTGACGTGTGCCATACACGCG
ACCGAACATGGATCAGATCACCGAGCGATCCAGACAACCTTTGACATGGACATGCCACAGCGGACCACTATGCAG
CGTCTGCTGTTCAAGAACGCGCCGTGGATTCTTATCGGAGCCAGAGTGAAGGACGAGCTTCGGCCGCTCCCTTGG
ACCGTCGACGTGCAGACGCAGGCGGACCAGTTGATGCGAGTTGTTGGCGAGGCAGTACACGAATTGACACCTCGG
GCACAACCGCCACCGTATGCGAAACGATGGTGGACGAAGGACCTAACGCGACTCCGACGGACGTACACATTCTGG
CGGAACCAGGCGAGAATGCAGCGACGAGCTGGCCAGTCGCGGCCGGACCTGGAAAAATGTGCCAAAGAAGCTGCT
AAAGAATATCACGACAACATCCGGAAACAGAAGAAAGCCCACTGGGACGACTTTGTTGCCGAGGAAAACAACATC
TGGAAAGCAGTCAGATATCTCAAACCCGGCAGGGACATTACGGACGACAAGGTTCCGCCTTTGAGGAGGGCGGAC
GGATCTGCAACTGAGGGCAAGGCAGAAGAGGCCGAGGAGCTGCTGAGCACATTCTTCCCACCACTACCAACTGGG
ATTAACGCCGAAGGAGAACGGCCGAAGCGGTCAGCGGTGCCAATGCCGGATCTGACCCTGGAAGAGATCGAAGAA
AAAGTAATGGCGGCGAAGCCGTGGAAAGCACCTGGAGAGGATGGCCTCCCGGCGATTGTGTGGAGGCGGCTCTGG
CACGTGGTCAAGTACCGCGTTTGGACCCTCTTCGATGCGTCGCTCCGGGACGGCGTGGTTCCCCGCCAATGGCGG
ACAGCGAAGATCATCCCACTGAAGAAGCCGGATAAAGGAGACTACGCCCTGGCTAAGGCGTGGCGACCGATCTCT
CTTCTGTCAACCCTTGGCAAGATCCTGGAGGCGGTCGTTGCAGAGCGTATCTCCTACGCAGTGGAGACGCACGGG
CTTCTACCGGCAAATCACTTCGGGGCGAGGAAACGTAGGTCAGCGGACCAGGCACTCATGCTTCTGCAGGAACAG
ATTTACAGAGCATGGCGAGCTGGTAAGGTGCTCAGCCTGATCAGTTTCGACGTCAAAGGCGCGTACAACGGAGTG
TGCAAGGAGCGATTGCTAGAAAGGATGAAGGCGAGGGGGATACCGGACAAACTGGTCACCTGGATGGACGCCTTC
TGCTCGGAGAGGACAGCTGCGGTGGTGGTGAATGGGCACACGTCTGAGCAACGAATCTTGCCACAAGCTGGCCTG
CCGCAAGGGTCACCGCTGTCGCCGATTGCATTCCTGTTCTTCAATGCAGACTTGGTGCAGAGACGGATAAATGCA
AAAGGTGGCTCCATTGCCTTTGTGGACGACTACTCGGCTTGGGTGACGGGGCCGACGGCGGAGGCGAACCGAGAG
GGCATCCAGTCGATCATCTCTGACTTGCTCGAGTGGGAGAAACGCAGCGGCGCCACGTTTGAAGCTGACAAGACG
ACCGTCATCCACTTCACACGGGTCGCGGAGCGGAGAAGCGGCACGTCATTCACGATCAAAGGGAAAGAGGTCAAA
CCGAAGAGCAGCGTCAAACTCCTGGGGGTGGTCATGGACACAAATCTCCGGTTCAAGGAGCATATTGTCAGAGCG
GCCGCCAAAGGGCTTGCTGCGGCCATGTGTTTGCGAAGACTAAAGATGATTTCCCCACGAATGGCGAGGCAATTG
TTCGTGGCGACGGTAGCACCCACCATGGACTACGGCTCCATTGTTTGGATGCAATCGTGTGGCATGAGAGAAGCG
GTCTGGCTGAACAGGGCTTAG
Transcript >Hirsu2|8428
ATGATGCTTGAGCCCTTCCGCATCCTACAGCTGAATGTGCGCAAGCGGGATCCGGTGCAGCAAAGCTTGATGAAC
GATGCAGACCTCAAGGATTTTGCCGTATTGGCAGTCTCTGAGCCGTTTGCGCGCAGCATTGATGGTAGGGTGGTG
ACGAGCCCCATGGGGCACATTAACTGGACGAAGATGATACCAACGTGCACACATGATGCGTCGTGGCCGATCCGC
AGCATGCTCTGGGTTCGGAACGACATTGAGGCGGAGCAGGTGCCGGTGCCGTCGGCCGACCTCACAGCAGCGGTG
CTTCGACTCGCGGAGAGGGACGTGATGGTGGTGTCGGTGTACGTGGAGGGCAACAGCAGCGAGGCACTGACGGTC
GTGGTAGGGCTGTTACACGATCTGGTCGATTGCTTTCGCGACAGGACAGGGAGACGCACGGATGTGTTGCTGGCG
GGAGACTTCAATCGTCACGACATACTCTGGGGCGGAGACGAGGTGTCAGCGAGAAGACAAGGGGAAGGCCAGCCC
ATTGTCGACCTGATGAACGAGCATGGTCTCTGCAGCCTTCTGCCGAGAGGGACGAAGACGTGGCAAGGGCCGGAC
AAGGAAAGCACCATTGACCTGGTGCTCGCGTCGTCAGAGCTGGCCGAGGAGACGGTGACGTGTGCCATACACGCG
ACCGAACATGGATCAGATCACCGAGCGATCCAGACAACCTTTGACATGGACATGCCACAGCGGACCACTATGCAG
CGTCTGCTGTTCAAGAACGCGCCGTGGATTCTTATCGGAGCCAGAGTGAAGGACGAGCTTCGGCCGCTCCCTTGG
ACCGTCGACGTGCAGACGCAGGCGGACCAGTTGATGCGAGTTGTTGGCGAGGCAGTACACGAATTGACACCTCGG
GCACAACCGCCACCGTATGCGAAACGATGGTGGACGAAGGACCTAACGCGACTCCGACGGACGTACACATTCTGG
CGGAACCAGGCGAGAATGCAGCGACGAGCTGGCCAGTCGCGGCCGGACCTGGAAAAATGTGCCAAAGAAGCTGCT
AAAGAATATCACGACAACATCCGGAAACAGAAGAAAGCCCACTGGGACGACTTTGTTGCCGAGGAAAACAACATC
TGGAAAGCAGTCAGATATCTCAAACCCGGCAGGGACATTACGGACGACAAGGTTCCGCCTTTGAGGAGGGCGGAC
GGATCTGCAACTGAGGGCAAGGCAGAAGAGGCCGAGGAGCTGCTGAGCACATTCTTCCCACCACTACCAACTGGG
ATTAACGCCGAAGGAGAACGGCCGAAGCGGTCAGCGGTGCCAATGCCGGATCTGACCCTGGAAGAGATCGAAGAA
AAAGTAATGGCGGCGAAGCCGTGGAAAGCACCTGGAGAGGATGGCCTCCCGGCGATTGTGTGGAGGCGGCTCTGG
CACGTGGTCAAGTACCGCGTTTGGACCCTCTTCGATGCGTCGCTCCGGGACGGCGTGGTTCCCCGCCAATGGCGG
ACAGCGAAGATCATCCCACTGAAGAAGCCGGATAAAGGAGACTACGCCCTGGCTAAGGCGTGGCGACCGATCTCT
CTTCTGTCAACCCTTGGCAAGATCCTGGAGGCGGTCGTTGCAGAGCGTATCTCCTACGCAGTGGAGACGCACGGG
CTTCTACCGGCAAATCACTTCGGGGCGAGGAAACGTAGGTCAGCGGACCAGGCACTCATGCTTCTGCAGGAACAG
ATTTACAGAGCATGGCGAGCTGGTAAGGTGCTCAGCCTGATCAGTTTCGACGTCAAAGGCGCGTACAACGGAGTG
TGCAAGGAGCGATTGCTAGAAAGGATGAAGGCGAGGGGGATACCGGACAAACTGGTCACCTGGATGGACGCCTTC
TGCTCGGAGAGGACAGCTGCGGTGGTGGTGAATGGGCACACGTCTGAGCAACGAATCTTGCCACAAGCTGGCCTG
CCGCAAGGGTCACCGCTGTCGCCGATTGCATTCCTGTTCTTCAATGCAGACTTGGTGCAGAGACGGATAAATGCA
AAAGGTGGCTCCATTGCCTTTGTGGACGACTACTCGGCTTGGGTGACGGGGCCGACGGCGGAGGCGAACCGAGAG
GGCATCCAGTCGATCATCTCTGACTTGCTCGAGTGGGAGAAACGCAGCGGCGCCACGTTTGAAGCTGACAAGACG
ACCGTCATCCACTTCACACGGGTCGCGGAGCGGAGAAGCGGCACGTCATTCACGATCAAAGGGAAAGAGGTCAAA
CCGAAGAGCAGCGTCAAACTCCTGGGGGTGGTCATGGACACAAATCTCCGGTTCAAGGAGCATATTGTCAGAGCG
GCCGCCAAAGGGCTTGCTGCGGCCATGTGTTTGCGAAGACTAAAGATGATTTCCCCACGAATGGCGAGGCAATTG
TTCGTGGCGACGGTAGCACCCACCATGGACTACGGCTCCATTGTTTGGATGCAATCGTGTGGCATGAGAGAAGCG
GTCTGGCTGAACAGGGCTTAG
Gene >Hirsu2|8428
ATGATGCTTGAGCCCTTCCGCATCCTACAGCTGAATGTGCGCAAGCGGGATCCGGTGCAGCAAAGCTTGATGAAC
GATGCAGACCTCAAGGATTTTGCCGTATTGGCAGTCTCTGAGCCGTTTGCGCGCAGCATTGATGGTAGGGTGGTG
ACGAGCCCCATGGGGCACATTAACTGGACGAAGATGATACCAACGTGCACACATGATGCGTCGTGGCCGATCCGC
AGCATGCTCTGGGTTCGGAACGACATTGAGGCGGAGCAGGTGCCGGTGCCGTCGGCCGACCTCACAGCAGCGGTG
CTTCGACTCGCGGAGAGGGACGTGATGGTGGTGTCGGTGTACGTGGAGGGCAACAGCAGCGAGGCACTGACGGTC
GTGGTAGGGCTGTTACACGATCTGGTCGATTGCTTTCGCGACAGGACAGGGAGACGCACGGATGTGTTGCTGGCG
GGAGACTTCAATCGTCACGACATACTCTGGGGCGGAGACGAGGTGTCAGCGAGAAGACAAGGGGAAGGCCAGCCC
ATTGTCGACCTGATGAACGAGCATGGTCTCTGCAGCCTTCTGCCGAGAGGGACGAAGACGTGGCAAGGGCCGGAC
AAGGAAAGCACCATTGACCTGGTGCTCGCGTCGTCAGAGCTGGCCGAGGAGACGGTGACGTGTGCCATACACGCG
ACCGAACATGGATCAGATCACCGAGCGATCCAGACAACCTTTGACATGGACATGCCACAGCGGACCACTATGCAG
CGTCTGCTGTTCAAGAACGCGCCGTGGATTCTTATCGGAGCCAGAGTGAAGGACGAGCTTCGGCCGCTCCCTTGG
ACCGTCGACGTGCAGACGCAGGCGGACCAGTTGATGCGAGTTGTTGGCGAGGCAGTACACGAATTGACACCTCGG
GCACAACCGCCACCGTATGCGAAACGATGGTGGACGAAGGACCTAACGCGACTCCGACGGACGTACACATTCTGG
CGGAACCAGGCGAGAATGCAGCGACGAGCTGGCCAGTCGCGGCCGGACCTGGAAAAATGTGCCAAAGAAGCTGCT
AAAGAATATCACGACAACATCCGGAAACAGAAGAAAGCCCACTGGGACGACTTTGTTGCCGAGGAAAACAACATC
TGGAAAGCAGTCAGATATCTCAAACCCGGCAGGGACATTACGGACGACAAGGTTCCGCCTTTGAGGAGGGCGGAC
GGATCTGCAACTGAGGGCAAGGCAGAAGAGGCCGAGGAGCTGCTGAGCACATTCTTCCCACCACTACCAACTGGG
ATTAACGCCGAAGGAGAACGGCCGAAGCGGTCAGCGGTGCCAATGCCGGATCTGACCCTGGAAGAGATCGAAGAA
AAAGTAATGGCGGCGAAGCCGTGGAAAGCACCTGGAGAGGATGGCCTCCCGGCGATTGTGTGGAGGCGGCTCTGG
CACGTGGTCAAGTACCGCGTTTGGACCCTCTTCGATGCGTCGCTCCGGGACGGCGTGGTTCCCCGCCAATGGCGG
ACAGCGAAGATCATCCCACTGAAGAAGCCGGATAAAGGAGACTACGCCCTGGCTAAGGCGTGGCGACCGATCTCT
CTTCTGTCAACCCTTGGCAAGATCCTGGAGGCGGTCGTTGCAGAGCGTATCTCCTACGCAGTGGAGACGCACGGG
CTTCTACCGGCAAATCACTTCGGGGCGAGGAAACGTAGGTCAGCGGACCAGGCACTCATGCTTCTGCAGGAACAG
ATTTACAGAGCATGGCGAGCTGGTAAGGTGCTCAGCCTGATCAGTTTCGACGTCAAAGGCGCGTACAACGGAGTG
TGCAAGGAGCGATTGCTAGAAAGGATGAAGGCGAGGGGGATACCGGACAAACTGGTCACCTGGATGGACGCCTTC
TGCTCGGAGAGGACAGCTGCGGTGGTGGTGAATGGGCACACGTCTGAGCAACGAATCTTGCCACAAGCTGGCCTG
CCGCAAGGGTCACCGCTGTCGCCGATTGCATTCCTGTTCTTCAATGCAGACTTGGTGCAGAGACGGATAAATGCA
AAAGGTGGCTCCATTGCCTTTGTGGACGACTACTCGGCTTGGGTGACGGGGCCGACGGCGGAGGCGAACCGAGAG
GGCATCCAGTCGATCATCTCTGACTTGCTCGAGTGGGAGAAACGCAGCGGCGCCACGTTTGAAGCTGACAAGACG
ACCGTCATCCACTTCACACGGGTCGCGGAGCGGAGAAGCGGCACGTCATTCACGATCAAAGGGAAAGAGGTCAAA
CCGAAGAGCAGCGTCAAACTCCTGGGGGTGGTCATGGACACAAATCTCCGGTTCAAGGAGCATATTGTCAGAGCG
GCCGCCAAAGGGCTTGCTGCGGCCATGTGTTTGCGAAGACTAAAGATGATTTCCCCACGAATGGCGAGGCAATTG
TTCGTGGCGACGGTAGCACCCACCATGGACTACGGCTCCATTGTTTGGATGCAATCGTGTGGCATGAGAGAAGCG
GTCTGGCTGAACAGGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail