Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8425
Gene name
LocationContig_55:8755..10768
Strand-
Gene length (bp)2013
Transcript length (bp)2013
Coding sequence length (bp)2013
Protein length (aa) 671

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 9.2E-17 12 165
PF00075 RNase_H RNase H 7.1E-09 388 520

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q95SX7|RTBS_DROME Probable RNA-directed DNA polymerase from transposon BS OS=Drosophila melanogaster GN=RTase PE=2 SV=1 31 297 6.0E-12
sp|P21328|RTJK_DROME RNA-directed DNA polymerase from mobile element jockey OS=Drosophila melanogaster GN=pol PE=1 SV=1 20 223 3.0E-09
sp|P16425|Y2R2_DROME Putative 115 kDa protein in type-1 retrotransposable element R1DM OS=Drosophila melanogaster GN=R1A1-elementORF2 PE=3 SV=1 31 283 2.0E-08

GO

GO Term Description Terminal node
GO:0004523 RNA-DNA hybrid ribonuclease activity Yes
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0140098 catalytic activity, acting on RNA No
GO:0016893 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters No
GO:0004518 nuclease activity No
GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004521 endoribonuclease activity No
GO:0004519 endonuclease activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0004540 ribonuclease activity No
GO:0140640 catalytic activity, acting on a nucleic acid No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus|Extracellular 0.4965 0.671 0.6604 0.0812 0.1304 0.051 0.1488 0.0279 0.0445 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup369
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|941
Ophiocordyceps subramaniannii Hirsu2|10220
Ophiocordyceps subramaniannii Hirsu2|1656
Ophiocordyceps subramaniannii Hirsu2|552
Ophiocordyceps subramaniannii Hirsu2|7707
Ophiocordyceps subramaniannii Hirsu2|7736
Ophiocordyceps subramaniannii Hirsu2|8187
Ophiocordyceps subramaniannii Hirsu2|84
Ophiocordyceps subramaniannii Hirsu2|8425 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8428

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8425
MFSVPYSVAATFGVTHDLGWPTNVVRWVGCFMEQRSARIRLEDTTTSTTPLTCGLPQGSPASPILFLLYTAPIYS
LGEPNSRFGYADDVATLICGRSLQETVALATRAASELIQWGADNGVVFDSDKTEVIHFTRPRYEGDLPSVWHGPV
EKKPQRDLRWLGVWFDRKLSFRTHVEKWAAKAKKVAEFLQSLSNTRRGIPPQSTRHAVTACVLPILLYGAHVWHP
GTLRPVWGSCRLIPPRITYLKNRIQQTLNVAMRAIAPVWRTTPIAALHRETGIPPAELLLTDALRRAAVRLRSLD
ARHPLTPRMSILPTPGRQLMQEYGIRPPRAARKQQASRLLRLHQMTAQAPRPRLQAPAPPQPDPTGDVDKTQAAR
SFREWLRVCPEDTLIVYTDGSQSMDGACGYGYSLWLGPDEVVYGSGRMPLAEVYDAEVEGALEGLRAALAWSPMT
PDRQRPIVVCLDNTAAIRAIRGGPSISSQAVAVTFAEIAARHGDVSTRWCPGHAGIIGNERADRLAKEGCRINGP
DRPPTYAFIKRQAKAAARRDFQEWWAAAAPSSYKSLGLKALLGCPPELHTKRQHLHRLLAARSGHGDFADYHERF
DHQEARVTCSCGRKKSPTHLFYCRKVSTRYRLRLAPTADKAISQALGRDFSRFLGLATSAEFFDRICHRH*
Coding >Hirsu2|8425
ATGTTCTCCGTCCCCTACAGCGTAGCAGCTACGTTTGGAGTCACCCATGATCTCGGCTGGCCGACGAACGTGGTC
CGATGGGTCGGATGCTTTATGGAGCAGCGGTCGGCCAGGATTCGGCTCGAGGACACCACGACGTCGACGACGCCG
CTGACTTGCGGGCTACCGCAGGGCTCGCCGGCATCTCCGATTCTCTTCCTCCTGTATACCGCACCTATATACTCA
CTAGGGGAACCGAACTCGCGCTTCGGCTACGCAGACGACGTAGCTACCCTGATCTGTGGCCGATCTCTGCAGGAG
ACGGTCGCCCTGGCCACGCGCGCTGCGAGCGAGCTTATTCAGTGGGGCGCCGACAATGGCGTCGTGTTCGATTCT
GACAAGACGGAAGTCATCCACTTCACAAGGCCTAGATATGAGGGTGACCTGCCGTCGGTCTGGCACGGGCCCGTG
GAGAAGAAGCCACAGCGGGACCTGCGCTGGCTCGGCGTCTGGTTTGACAGAAAGCTCTCGTTCCGAACACATGTG
GAGAAGTGGGCCGCGAAGGCAAAGAAGGTCGCCGAGTTTCTCCAGAGCCTCTCAAACACGCGGCGCGGAATTCCT
CCTCAGTCGACGCGGCATGCGGTCACGGCCTGCGTCCTCCCGATCCTCCTCTATGGGGCCCACGTCTGGCATCCA
GGGACGCTCCGGCCTGTGTGGGGATCGTGCCGGTTGATCCCGCCGCGAATCACTTACTTGAAGAATAGAATCCAG
CAGACGCTGAACGTGGCGATGCGTGCTATCGCGCCTGTGTGGCGCACCACACCGATTGCGGCCCTCCACCGGGAG
ACCGGGATACCGCCCGCCGAGCTACTTCTCACGGACGCCCTGAGGCGCGCCGCGGTGCGCCTACGCTCCTTGGAC
GCACGGCATCCGCTGACGCCCCGCATGAGCATCCTCCCAACGCCTGGGCGGCAGTTGATGCAGGAGTACGGCATA
CGGCCGCCCCGCGCGGCCCGAAAGCAGCAGGCCTCGCGACTGCTTCGCCTTCACCAAATGACGGCCCAAGCGCCG
AGGCCGCGGCTTCAAGCCCCAGCCCCTCCGCAGCCGGACCCAACAGGGGATGTAGACAAGACCCAGGCGGCGAGG
AGTTTCCGTGAGTGGCTCCGGGTATGCCCCGAAGATACACTTATCGTCTACACTGACGGTTCGCAAAGCATGGAC
GGCGCCTGCGGGTATGGGTACTCGCTGTGGCTAGGCCCAGACGAAGTGGTCTATGGCAGCGGCCGGATGCCACTG
GCCGAGGTATACGACGCAGAGGTCGAGGGTGCTCTCGAAGGACTTCGAGCGGCGCTGGCATGGTCCCCGATGACT
CCGGACCGGCAACGCCCGATCGTCGTCTGCCTTGACAATACGGCGGCGATAAGAGCCATACGAGGCGGGCCGTCG
ATCTCGTCACAAGCGGTGGCGGTGACGTTCGCCGAGATTGCAGCTCGACACGGCGACGTCAGCACGCGCTGGTGT
CCCGGCCACGCGGGTATCATCGGCAACGAGCGGGCTGACCGGCTGGCCAAGGAGGGCTGCCGAATTAACGGCCCG
GACAGGCCCCCGACCTACGCGTTCATCAAGAGACAGGCAAAGGCTGCGGCCAGACGCGATTTCCAAGAATGGTGG
GCGGCGGCGGCCCCGAGCAGCTACAAGAGCCTGGGGCTCAAGGCCTTGCTCGGGTGCCCGCCGGAACTGCACACC
AAACGACAGCACCTCCACCGCCTGCTTGCCGCAAGGAGCGGGCACGGAGACTTTGCCGATTACCACGAGAGGTTC
GACCACCAAGAGGCCCGGGTTACATGTTCCTGTGGGAGGAAGAAATCACCGACGCACCTCTTCTACTGCCGGAAG
GTTAGCACTCGATACCGCCTGAGGCTGGCTCCAACCGCGGACAAGGCCATTAGCCAGGCGCTAGGGCGGGACTTT
AGCCGGTTCCTCGGGCTGGCGACGAGTGCAGAGTTCTTCGATCGGATCTGCCACCGTCATTGA
Transcript >Hirsu2|8425
ATGTTCTCCGTCCCCTACAGCGTAGCAGCTACGTTTGGAGTCACCCATGATCTCGGCTGGCCGACGAACGTGGTC
CGATGGGTCGGATGCTTTATGGAGCAGCGGTCGGCCAGGATTCGGCTCGAGGACACCACGACGTCGACGACGCCG
CTGACTTGCGGGCTACCGCAGGGCTCGCCGGCATCTCCGATTCTCTTCCTCCTGTATACCGCACCTATATACTCA
CTAGGGGAACCGAACTCGCGCTTCGGCTACGCAGACGACGTAGCTACCCTGATCTGTGGCCGATCTCTGCAGGAG
ACGGTCGCCCTGGCCACGCGCGCTGCGAGCGAGCTTATTCAGTGGGGCGCCGACAATGGCGTCGTGTTCGATTCT
GACAAGACGGAAGTCATCCACTTCACAAGGCCTAGATATGAGGGTGACCTGCCGTCGGTCTGGCACGGGCCCGTG
GAGAAGAAGCCACAGCGGGACCTGCGCTGGCTCGGCGTCTGGTTTGACAGAAAGCTCTCGTTCCGAACACATGTG
GAGAAGTGGGCCGCGAAGGCAAAGAAGGTCGCCGAGTTTCTCCAGAGCCTCTCAAACACGCGGCGCGGAATTCCT
CCTCAGTCGACGCGGCATGCGGTCACGGCCTGCGTCCTCCCGATCCTCCTCTATGGGGCCCACGTCTGGCATCCA
GGGACGCTCCGGCCTGTGTGGGGATCGTGCCGGTTGATCCCGCCGCGAATCACTTACTTGAAGAATAGAATCCAG
CAGACGCTGAACGTGGCGATGCGTGCTATCGCGCCTGTGTGGCGCACCACACCGATTGCGGCCCTCCACCGGGAG
ACCGGGATACCGCCCGCCGAGCTACTTCTCACGGACGCCCTGAGGCGCGCCGCGGTGCGCCTACGCTCCTTGGAC
GCACGGCATCCGCTGACGCCCCGCATGAGCATCCTCCCAACGCCTGGGCGGCAGTTGATGCAGGAGTACGGCATA
CGGCCGCCCCGCGCGGCCCGAAAGCAGCAGGCCTCGCGACTGCTTCGCCTTCACCAAATGACGGCCCAAGCGCCG
AGGCCGCGGCTTCAAGCCCCAGCCCCTCCGCAGCCGGACCCAACAGGGGATGTAGACAAGACCCAGGCGGCGAGG
AGTTTCCGTGAGTGGCTCCGGGTATGCCCCGAAGATACACTTATCGTCTACACTGACGGTTCGCAAAGCATGGAC
GGCGCCTGCGGGTATGGGTACTCGCTGTGGCTAGGCCCAGACGAAGTGGTCTATGGCAGCGGCCGGATGCCACTG
GCCGAGGTATACGACGCAGAGGTCGAGGGTGCTCTCGAAGGACTTCGAGCGGCGCTGGCATGGTCCCCGATGACT
CCGGACCGGCAACGCCCGATCGTCGTCTGCCTTGACAATACGGCGGCGATAAGAGCCATACGAGGCGGGCCGTCG
ATCTCGTCACAAGCGGTGGCGGTGACGTTCGCCGAGATTGCAGCTCGACACGGCGACGTCAGCACGCGCTGGTGT
CCCGGCCACGCGGGTATCATCGGCAACGAGCGGGCTGACCGGCTGGCCAAGGAGGGCTGCCGAATTAACGGCCCG
GACAGGCCCCCGACCTACGCGTTCATCAAGAGACAGGCAAAGGCTGCGGCCAGACGCGATTTCCAAGAATGGTGG
GCGGCGGCGGCCCCGAGCAGCTACAAGAGCCTGGGGCTCAAGGCCTTGCTCGGGTGCCCGCCGGAACTGCACACC
AAACGACAGCACCTCCACCGCCTGCTTGCCGCAAGGAGCGGGCACGGAGACTTTGCCGATTACCACGAGAGGTTC
GACCACCAAGAGGCCCGGGTTACATGTTCCTGTGGGAGGAAGAAATCACCGACGCACCTCTTCTACTGCCGGAAG
GTTAGCACTCGATACCGCCTGAGGCTGGCTCCAACCGCGGACAAGGCCATTAGCCAGGCGCTAGGGCGGGACTTT
AGCCGGTTCCTCGGGCTGGCGACGAGTGCAGAGTTCTTCGATCGGATCTGCCACCGTCATTGA
Gene >Hirsu2|8425
ATGTTCTCCGTCCCCTACAGCGTAGCAGCTACGTTTGGAGTCACCCATGATCTCGGCTGGCCGACGAACGTGGTC
CGATGGGTCGGATGCTTTATGGAGCAGCGGTCGGCCAGGATTCGGCTCGAGGACACCACGACGTCGACGACGCCG
CTGACTTGCGGGCTACCGCAGGGCTCGCCGGCATCTCCGATTCTCTTCCTCCTGTATACCGCACCTATATACTCA
CTAGGGGAACCGAACTCGCGCTTCGGCTACGCAGACGACGTAGCTACCCTGATCTGTGGCCGATCTCTGCAGGAG
ACGGTCGCCCTGGCCACGCGCGCTGCGAGCGAGCTTATTCAGTGGGGCGCCGACAATGGCGTCGTGTTCGATTCT
GACAAGACGGAAGTCATCCACTTCACAAGGCCTAGATATGAGGGTGACCTGCCGTCGGTCTGGCACGGGCCCGTG
GAGAAGAAGCCACAGCGGGACCTGCGCTGGCTCGGCGTCTGGTTTGACAGAAAGCTCTCGTTCCGAACACATGTG
GAGAAGTGGGCCGCGAAGGCAAAGAAGGTCGCCGAGTTTCTCCAGAGCCTCTCAAACACGCGGCGCGGAATTCCT
CCTCAGTCGACGCGGCATGCGGTCACGGCCTGCGTCCTCCCGATCCTCCTCTATGGGGCCCACGTCTGGCATCCA
GGGACGCTCCGGCCTGTGTGGGGATCGTGCCGGTTGATCCCGCCGCGAATCACTTACTTGAAGAATAGAATCCAG
CAGACGCTGAACGTGGCGATGCGTGCTATCGCGCCTGTGTGGCGCACCACACCGATTGCGGCCCTCCACCGGGAG
ACCGGGATACCGCCCGCCGAGCTACTTCTCACGGACGCCCTGAGGCGCGCCGCGGTGCGCCTACGCTCCTTGGAC
GCACGGCATCCGCTGACGCCCCGCATGAGCATCCTCCCAACGCCTGGGCGGCAGTTGATGCAGGAGTACGGCATA
CGGCCGCCCCGCGCGGCCCGAAAGCAGCAGGCCTCGCGACTGCTTCGCCTTCACCAAATGACGGCCCAAGCGCCG
AGGCCGCGGCTTCAAGCCCCAGCCCCTCCGCAGCCGGACCCAACAGGGGATGTAGACAAGACCCAGGCGGCGAGG
AGTTTCCGTGAGTGGCTCCGGGTATGCCCCGAAGATACACTTATCGTCTACACTGACGGTTCGCAAAGCATGGAC
GGCGCCTGCGGGTATGGGTACTCGCTGTGGCTAGGCCCAGACGAAGTGGTCTATGGCAGCGGCCGGATGCCACTG
GCCGAGGTATACGACGCAGAGGTCGAGGGTGCTCTCGAAGGACTTCGAGCGGCGCTGGCATGGTCCCCGATGACT
CCGGACCGGCAACGCCCGATCGTCGTCTGCCTTGACAATACGGCGGCGATAAGAGCCATACGAGGCGGGCCGTCG
ATCTCGTCACAAGCGGTGGCGGTGACGTTCGCCGAGATTGCAGCTCGACACGGCGACGTCAGCACGCGCTGGTGT
CCCGGCCACGCGGGTATCATCGGCAACGAGCGGGCTGACCGGCTGGCCAAGGAGGGCTGCCGAATTAACGGCCCG
GACAGGCCCCCGACCTACGCGTTCATCAAGAGACAGGCAAAGGCTGCGGCCAGACGCGATTTCCAAGAATGGTGG
GCGGCGGCGGCCCCGAGCAGCTACAAGAGCCTGGGGCTCAAGGCCTTGCTCGGGTGCCCGCCGGAACTGCACACC
AAACGACAGCACCTCCACCGCCTGCTTGCCGCAAGGAGCGGGCACGGAGACTTTGCCGATTACCACGAGAGGTTC
GACCACCAAGAGGCCCGGGTTACATGTTCCTGTGGGAGGAAGAAATCACCGACGCACCTCTTCTACTGCCGGAAG
GTTAGCACTCGATACCGCCTGAGGCTGGCTCCAACCGCGGACAAGGCCATTAGCCAGGCGCTAGGGCGGGACTTT
AGCCGGTTCCTCGGGCTGGCGACGAGTGCAGAGTTCTTCGATCGGATCTGCCACCGTCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail