Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8423
Gene name
LocationContig_55:592..4732
Strand-
Gene length (bp)4140
Transcript length (bp)4140
Coding sequence length (bp)4140
Protein length (aa) 1380

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 3.2E-08 1283 1375

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 455 885 4.0E-16
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1250 1376 1.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8423
MSARSEVILSKPSDWADWYEDFVARAETSRIIKYVDIDQEGPELVEPQEPMTSEELLAKLNRDASAAWMQASQAN
PDAAGPRPEPAEDLTNAQWNRIARLQAEYKVKIVTYSNYQRAYADLAAWVRSTVDKTYLGNTSSKSNLRTIIREL
KSSLAPTDTEQFDEARLRYRQVLSQTKRVKPEDWIVAWNKARLEGEKHKIPELQGYAGTSDFLTAVTTFDPAWAK
NQIGQVAANRKRNLDSGFTLREPELFQEEVRRTRAAAKLTDSVFAASGMHDTSANSPCPCGLPSSKHSWKAKDCA
AVQIAVNGASKDGRQVRPTRLKICKEAVKLAKWKSLVDAVKESGGDLQQTNSPEEPRKRGDFVGVAISAECLSDG
TTESVFAALQKQHPLYNSTIYDGGATTHVVNNKDLLADIREASESDHIMIGDSSLKIQARGTRRMEDILDGEDGK
NTRALVLLDVAYVPRFHTNLFSAKKLEKKGLWHCGFDNTLRMGTYDDNDVLCRLTEKYDLKIVEYKPVARSYFQL
PQRPISVFNAFQDAFSSVQTESLQPRPRRRIATSRQPPPPRWDSAEIWHRRACHAGPKALEQLVLQTRGVRIKGP
TTAQCTACGTSKATEIISRRESPHRSRQPFYRVFVDIFGFSAAYNGHRYILLMTDEYSGMMFFSSMPSKAEATKI
VQDFDARIKRHTGASLCKIRVDNERALVNLPHQRDSEFQTWAAEEGMEIELPPPHTKEPTGGAERPGGINQTRMR
SMGGLLPLELWPEFYRAAVWIHNILPSEGNKWMSPKEKMDRWFHQHFRWYRPPNVDFDATKDHRPHWCGIYAYGC
KAYPLNPRYKAGKDTNLFKLSPRAHVGYLVGYHASNIYRIWVPKLNRVILTRDVRFNEEEFFDPEKEDQLETERI
AEYAPILQTHEPLPTQDWDSILNEFLFEFDQNVLGISPEGSNSGVDGDGGTVTDVAETVPRITQSMQTPSQRLLT
PLGESTTTLPTPDPTPQLARRDASPAQRSDFGSDTLRLDPALQQASSSPAQRTKDGPCTNSSTSTPDPALQQTES
SPAQRTEDGLNGDPDNFFYHASEASQSESPAQSDQPTRAKRTEQAQRSSAPSPEELGRANEPEGSQECEDSQGST
TPDDRTSPTEVIKDTIVCKPLPPPGEQSVQQQSDDQPTPATAQSEPRIRRRRHQRELYGEQPTRKSARTPKPNRK
TNDYAHSVFTALLPTDKHPEGDLATFHSVFLAAVSKAARDHRFHRDDLVRLPKRYQDLENHPKGPEFKEAIRKEL
RDLLQRGTWRLIEREKAHGPPLPLKWVFTYKFDQDGYLQRCKARICVRGDLQEDDDGLETYAATLAAKTFRIAMA
TAAGFDLDIRQFDVGNAFLYSDLNKDHPI*
Coding >Hirsu2|8423
ATGTCAGCCAGGTCTGAAGTGATCCTCTCCAAGCCGTCGGATTGGGCCGATTGGTACGAAGACTTCGTCGCTAGG
GCCGAGACCTCCAGGATCATCAAGTATGTCGACATCGATCAGGAGGGACCAGAACTAGTTGAACCACAGGAGCCC
ATGACGTCTGAGGAGCTACTCGCCAAGCTCAACAGAGATGCATCTGCTGCTTGGATGCAGGCATCCCAGGCAAAT
CCTGACGCCGCTGGACCACGTCCCGAACCAGCCGAAGATCTGACTAATGCGCAATGGAACCGGATCGCTCGTCTC
CAGGCGGAATACAAGGTCAAGATAGTTACATACTCTAACTATCAACGCGCCTACGCTGACCTTGCCGCTTGGGTC
CGATCAACCGTTGACAAGACCTACCTCGGCAATACCTCGTCCAAGTCAAACCTCCGCACCATTATCCGCGAGCTA
AAGTCAAGTCTTGCACCCACCGACACAGAGCAGTTCGACGAGGCGCGTTTGAGATACCGCCAAGTCCTCTCTCAA
ACCAAAAGGGTGAAACCAGAAGACTGGATCGTGGCTTGGAACAAGGCTAGGCTTGAAGGGGAGAAACATAAGATC
CCGGAGCTCCAAGGATACGCTGGAACCAGCGATTTCTTGACCGCAGTCACTACCTTTGATCCAGCTTGGGCCAAG
AACCAGATAGGCCAGGTTGCAGCCAACAGAAAGAGGAACCTTGACTCGGGATTCACGCTCCGCGAGCCCGAACTC
TTCCAAGAGGAGGTCCGCCGTACCAGGGCTGCTGCCAAGCTGACCGACAGTGTGTTCGCAGCCTCTGGAATGCAT
GACACCTCAGCCAATAGCCCCTGTCCGTGCGGATTACCTTCCTCCAAGCACTCCTGGAAAGCCAAGGACTGCGCA
GCTGTACAAATTGCAGTCAATGGTGCTTCTAAGGATGGAAGACAGGTTCGACCTACACGCCTGAAGATCTGCAAA
GAAGCCGTGAAGCTGGCCAAGTGGAAGAGCCTCGTTGACGCAGTCAAGGAATCTGGAGGTGACCTGCAGCAGACC
AACAGCCCGGAGGAGCCGCGGAAGCGAGGGGACTTTGTCGGTGTGGCCATCAGCGCTGAATGCCTCTCTGATGGA
ACTACAGAATCGGTCTTTGCAGCATTGCAGAAGCAGCATCCTCTTTACAACTCCACAATCTACGACGGAGGTGCA
ACCACACATGTCGTCAACAACAAGGACCTGCTAGCCGACATCAGGGAAGCGTCAGAGTCTGACCACATCATGATT
GGCGACAGCAGCCTCAAGATCCAGGCGAGAGGAACTCGAAGGATGGAAGACATACTTGATGGAGAGGACGGAAAG
AACACACGGGCACTTGTCTTGCTTGATGTGGCCTACGTTCCGCGATTCCACACCAACCTTTTCAGCGCAAAGAAG
CTTGAAAAGAAGGGCCTGTGGCACTGCGGATTTGACAACACGCTTCGAATGGGGACGTACGACGACAATGACGTG
CTTTGTCGGCTTACCGAAAAGTACGATCTCAAAATAGTCGAATACAAGCCTGTTGCACGCTCTTACTTCCAGCTT
CCACAACGGCCAATCTCCGTGTTCAATGCCTTCCAAGATGCCTTCTCATCCGTCCAGACGGAGAGCCTGCAGCCA
AGACCACGCCGGAGGATCGCAACATCAAGACAACCACCGCCTCCACGCTGGGACTCCGCTGAGATATGGCACCGT
CGAGCTTGCCACGCAGGGCCAAAAGCACTAGAACAACTTGTCTTACAGACAAGGGGAGTCCGCATTAAGGGCCCG
ACAACCGCCCAATGCACTGCTTGCGGCACTAGCAAAGCCACTGAGATTATCTCCCGCAGGGAATCACCGCACAGA
TCGAGACAACCGTTCTATCGGGTCTTCGTCGACATCTTCGGATTCTCTGCGGCCTACAACGGACACCGCTATATT
CTACTGATGACTGACGAGTATAGTGGCATGATGTTCTTTAGCTCCATGCCATCGAAGGCGGAAGCCACCAAGATC
GTTCAGGATTTTGACGCCCGCATTAAGAGACATACAGGAGCATCCCTTTGCAAAATCAGAGTCGACAACGAAAGG
GCGCTCGTTAATCTTCCACACCAGCGTGATTCTGAATTCCAGACCTGGGCAGCTGAGGAAGGAATGGAGATCGAA
CTTCCGCCGCCACACACCAAGGAACCAACAGGTGGCGCGGAGCGACCCGGTGGTATCAATCAGACACGAATGCGC
AGCATGGGGGGCCTTCTTCCCCTAGAACTCTGGCCAGAGTTCTACCGTGCAGCCGTCTGGATACATAACATCCTT
CCAAGCGAAGGAAACAAGTGGATGTCGCCTAAGGAGAAGATGGACCGCTGGTTCCACCAACACTTTCGATGGTAT
CGACCGCCAAACGTCGACTTTGATGCAACAAAGGACCACCGACCGCACTGGTGTGGGATTTACGCATACGGTTGC
AAAGCATATCCTTTGAATCCCCGCTACAAGGCTGGAAAGGACACCAATCTCTTCAAGCTTAGCCCACGAGCGCAC
GTTGGATACCTTGTTGGCTACCACGCCAGCAATATCTACCGCATCTGGGTCCCTAAGCTCAATCGGGTTATTCTA
ACTCGGGATGTACGATTCAACGAGGAAGAATTCTTCGATCCAGAAAAGGAGGACCAGTTGGAGACTGAGCGCATT
GCGGAATACGCTCCAATACTGCAAACGCATGAGCCGCTTCCAACACAAGACTGGGACTCCATCCTGAATGAGTTT
CTCTTCGAATTCGACCAAAATGTCCTGGGTATAAGCCCGGAGGGTTCGAACTCGGGGGTGGATGGCGATGGAGGA
ACCGTCACGGACGTCGCAGAGACCGTGCCACGAATCACGCAGTCTATGCAAACCCCATCTCAGAGACTTCTCACA
CCCCTGGGCGAATCCACAACAACTCTTCCCACACCGGATCCAACGCCACAGCTGGCAAGGAGGGACGCCTCCCCA
GCGCAACGTTCAGATTTCGGATCAGACACCCTAAGACTAGACCCGGCGTTGCAGCAGGCTTCGAGCTCCCCTGCC
CAACGAACCAAGGATGGTCCATGTACTAATTCAAGCACCTCAACACCAGATCCGGCGTTGCAGCAGACTGAGAGC
TCCCCTGCCCAACGAACCGAAGATGGTTTGAACGGTGATCCAGACAATTTCTTCTACCATGCTTCTGAAGCCTCT
CAATCCGAGTCACCAGCTCAGTCTGACCAACCGACTCGAGCGAAGAGAACAGAACAGGCTCAAAGATCAAGCGCT
CCCTCGCCCGAAGAGCTTGGAAGGGCCAATGAGCCAGAGGGCAGCCAGGAATGCGAAGATAGTCAAGGATCCACC
ACACCAGACGATCGTACCAGTCCTACCGAGGTCATCAAGGACACGATCGTATGCAAACCGCTGCCACCACCAGGC
GAGCAATCGGTGCAGCAGCAATCAGATGACCAACCAACTCCTGCCACGGCACAAAGCGAACCGCGCATTCGTCGC
CGCCGTCACCAGCGGGAACTTTACGGTGAACAGCCGACTCGCAAGAGTGCTCGGACACCGAAGCCAAACCGGAAG
ACCAATGACTACGCACACAGCGTTTTCACTGCCCTGCTTCCAACTGATAAACATCCTGAGGGAGACCTAGCGACA
TTTCACAGTGTTTTTCTCGCAGCAGTCTCCAAAGCCGCACGCGACCATCGGTTCCATCGAGATGACCTTGTGCGA
CTCCCGAAGAGGTACCAAGACCTTGAAAACCACCCCAAGGGACCCGAATTCAAGGAAGCTATTCGGAAAGAGCTG
CGTGATCTGCTCCAACGAGGCACGTGGAGGTTGATCGAACGCGAAAAGGCACATGGACCGCCTCTTCCACTGAAG
TGGGTGTTCACCTATAAGTTCGATCAAGATGGCTACCTCCAGAGGTGTAAGGCGCGCATCTGTGTCCGTGGAGAT
CTCCAAGAAGACGACGACGGACTAGAAACCTATGCAGCCACCCTCGCAGCAAAGACCTTCCGGATCGCCATGGCA
ACTGCAGCCGGATTCGACCTTGACATTAGACAATTTGACGTTGGCAACGCCTTCCTGTACAGCGACCTAAATAAG
GACCATCCCATCTAG
Transcript >Hirsu2|8423
ATGTCAGCCAGGTCTGAAGTGATCCTCTCCAAGCCGTCGGATTGGGCCGATTGGTACGAAGACTTCGTCGCTAGG
GCCGAGACCTCCAGGATCATCAAGTATGTCGACATCGATCAGGAGGGACCAGAACTAGTTGAACCACAGGAGCCC
ATGACGTCTGAGGAGCTACTCGCCAAGCTCAACAGAGATGCATCTGCTGCTTGGATGCAGGCATCCCAGGCAAAT
CCTGACGCCGCTGGACCACGTCCCGAACCAGCCGAAGATCTGACTAATGCGCAATGGAACCGGATCGCTCGTCTC
CAGGCGGAATACAAGGTCAAGATAGTTACATACTCTAACTATCAACGCGCCTACGCTGACCTTGCCGCTTGGGTC
CGATCAACCGTTGACAAGACCTACCTCGGCAATACCTCGTCCAAGTCAAACCTCCGCACCATTATCCGCGAGCTA
AAGTCAAGTCTTGCACCCACCGACACAGAGCAGTTCGACGAGGCGCGTTTGAGATACCGCCAAGTCCTCTCTCAA
ACCAAAAGGGTGAAACCAGAAGACTGGATCGTGGCTTGGAACAAGGCTAGGCTTGAAGGGGAGAAACATAAGATC
CCGGAGCTCCAAGGATACGCTGGAACCAGCGATTTCTTGACCGCAGTCACTACCTTTGATCCAGCTTGGGCCAAG
AACCAGATAGGCCAGGTTGCAGCCAACAGAAAGAGGAACCTTGACTCGGGATTCACGCTCCGCGAGCCCGAACTC
TTCCAAGAGGAGGTCCGCCGTACCAGGGCTGCTGCCAAGCTGACCGACAGTGTGTTCGCAGCCTCTGGAATGCAT
GACACCTCAGCCAATAGCCCCTGTCCGTGCGGATTACCTTCCTCCAAGCACTCCTGGAAAGCCAAGGACTGCGCA
GCTGTACAAATTGCAGTCAATGGTGCTTCTAAGGATGGAAGACAGGTTCGACCTACACGCCTGAAGATCTGCAAA
GAAGCCGTGAAGCTGGCCAAGTGGAAGAGCCTCGTTGACGCAGTCAAGGAATCTGGAGGTGACCTGCAGCAGACC
AACAGCCCGGAGGAGCCGCGGAAGCGAGGGGACTTTGTCGGTGTGGCCATCAGCGCTGAATGCCTCTCTGATGGA
ACTACAGAATCGGTCTTTGCAGCATTGCAGAAGCAGCATCCTCTTTACAACTCCACAATCTACGACGGAGGTGCA
ACCACACATGTCGTCAACAACAAGGACCTGCTAGCCGACATCAGGGAAGCGTCAGAGTCTGACCACATCATGATT
GGCGACAGCAGCCTCAAGATCCAGGCGAGAGGAACTCGAAGGATGGAAGACATACTTGATGGAGAGGACGGAAAG
AACACACGGGCACTTGTCTTGCTTGATGTGGCCTACGTTCCGCGATTCCACACCAACCTTTTCAGCGCAAAGAAG
CTTGAAAAGAAGGGCCTGTGGCACTGCGGATTTGACAACACGCTTCGAATGGGGACGTACGACGACAATGACGTG
CTTTGTCGGCTTACCGAAAAGTACGATCTCAAAATAGTCGAATACAAGCCTGTTGCACGCTCTTACTTCCAGCTT
CCACAACGGCCAATCTCCGTGTTCAATGCCTTCCAAGATGCCTTCTCATCCGTCCAGACGGAGAGCCTGCAGCCA
AGACCACGCCGGAGGATCGCAACATCAAGACAACCACCGCCTCCACGCTGGGACTCCGCTGAGATATGGCACCGT
CGAGCTTGCCACGCAGGGCCAAAAGCACTAGAACAACTTGTCTTACAGACAAGGGGAGTCCGCATTAAGGGCCCG
ACAACCGCCCAATGCACTGCTTGCGGCACTAGCAAAGCCACTGAGATTATCTCCCGCAGGGAATCACCGCACAGA
TCGAGACAACCGTTCTATCGGGTCTTCGTCGACATCTTCGGATTCTCTGCGGCCTACAACGGACACCGCTATATT
CTACTGATGACTGACGAGTATAGTGGCATGATGTTCTTTAGCTCCATGCCATCGAAGGCGGAAGCCACCAAGATC
GTTCAGGATTTTGACGCCCGCATTAAGAGACATACAGGAGCATCCCTTTGCAAAATCAGAGTCGACAACGAAAGG
GCGCTCGTTAATCTTCCACACCAGCGTGATTCTGAATTCCAGACCTGGGCAGCTGAGGAAGGAATGGAGATCGAA
CTTCCGCCGCCACACACCAAGGAACCAACAGGTGGCGCGGAGCGACCCGGTGGTATCAATCAGACACGAATGCGC
AGCATGGGGGGCCTTCTTCCCCTAGAACTCTGGCCAGAGTTCTACCGTGCAGCCGTCTGGATACATAACATCCTT
CCAAGCGAAGGAAACAAGTGGATGTCGCCTAAGGAGAAGATGGACCGCTGGTTCCACCAACACTTTCGATGGTAT
CGACCGCCAAACGTCGACTTTGATGCAACAAAGGACCACCGACCGCACTGGTGTGGGATTTACGCATACGGTTGC
AAAGCATATCCTTTGAATCCCCGCTACAAGGCTGGAAAGGACACCAATCTCTTCAAGCTTAGCCCACGAGCGCAC
GTTGGATACCTTGTTGGCTACCACGCCAGCAATATCTACCGCATCTGGGTCCCTAAGCTCAATCGGGTTATTCTA
ACTCGGGATGTACGATTCAACGAGGAAGAATTCTTCGATCCAGAAAAGGAGGACCAGTTGGAGACTGAGCGCATT
GCGGAATACGCTCCAATACTGCAAACGCATGAGCCGCTTCCAACACAAGACTGGGACTCCATCCTGAATGAGTTT
CTCTTCGAATTCGACCAAAATGTCCTGGGTATAAGCCCGGAGGGTTCGAACTCGGGGGTGGATGGCGATGGAGGA
ACCGTCACGGACGTCGCAGAGACCGTGCCACGAATCACGCAGTCTATGCAAACCCCATCTCAGAGACTTCTCACA
CCCCTGGGCGAATCCACAACAACTCTTCCCACACCGGATCCAACGCCACAGCTGGCAAGGAGGGACGCCTCCCCA
GCGCAACGTTCAGATTTCGGATCAGACACCCTAAGACTAGACCCGGCGTTGCAGCAGGCTTCGAGCTCCCCTGCC
CAACGAACCAAGGATGGTCCATGTACTAATTCAAGCACCTCAACACCAGATCCGGCGTTGCAGCAGACTGAGAGC
TCCCCTGCCCAACGAACCGAAGATGGTTTGAACGGTGATCCAGACAATTTCTTCTACCATGCTTCTGAAGCCTCT
CAATCCGAGTCACCAGCTCAGTCTGACCAACCGACTCGAGCGAAGAGAACAGAACAGGCTCAAAGATCAAGCGCT
CCCTCGCCCGAAGAGCTTGGAAGGGCCAATGAGCCAGAGGGCAGCCAGGAATGCGAAGATAGTCAAGGATCCACC
ACACCAGACGATCGTACCAGTCCTACCGAGGTCATCAAGGACACGATCGTATGCAAACCGCTGCCACCACCAGGC
GAGCAATCGGTGCAGCAGCAATCAGATGACCAACCAACTCCTGCCACGGCACAAAGCGAACCGCGCATTCGTCGC
CGCCGTCACCAGCGGGAACTTTACGGTGAACAGCCGACTCGCAAGAGTGCTCGGACACCGAAGCCAAACCGGAAG
ACCAATGACTACGCACACAGCGTTTTCACTGCCCTGCTTCCAACTGATAAACATCCTGAGGGAGACCTAGCGACA
TTTCACAGTGTTTTTCTCGCAGCAGTCTCCAAAGCCGCACGCGACCATCGGTTCCATCGAGATGACCTTGTGCGA
CTCCCGAAGAGGTACCAAGACCTTGAAAACCACCCCAAGGGACCCGAATTCAAGGAAGCTATTCGGAAAGAGCTG
CGTGATCTGCTCCAACGAGGCACGTGGAGGTTGATCGAACGCGAAAAGGCACATGGACCGCCTCTTCCACTGAAG
TGGGTGTTCACCTATAAGTTCGATCAAGATGGCTACCTCCAGAGGTGTAAGGCGCGCATCTGTGTCCGTGGAGAT
CTCCAAGAAGACGACGACGGACTAGAAACCTATGCAGCCACCCTCGCAGCAAAGACCTTCCGGATCGCCATGGCA
ACTGCAGCCGGATTCGACCTTGACATTAGACAATTTGACGTTGGCAACGCCTTCCTGTACAGCGACCTAAATAAG
GACCATCCCATCTAG
Gene >Hirsu2|8423
ATGTCAGCCAGGTCTGAAGTGATCCTCTCCAAGCCGTCGGATTGGGCCGATTGGTACGAAGACTTCGTCGCTAGG
GCCGAGACCTCCAGGATCATCAAGTATGTCGACATCGATCAGGAGGGACCAGAACTAGTTGAACCACAGGAGCCC
ATGACGTCTGAGGAGCTACTCGCCAAGCTCAACAGAGATGCATCTGCTGCTTGGATGCAGGCATCCCAGGCAAAT
CCTGACGCCGCTGGACCACGTCCCGAACCAGCCGAAGATCTGACTAATGCGCAATGGAACCGGATCGCTCGTCTC
CAGGCGGAATACAAGGTCAAGATAGTTACATACTCTAACTATCAACGCGCCTACGCTGACCTTGCCGCTTGGGTC
CGATCAACCGTTGACAAGACCTACCTCGGCAATACCTCGTCCAAGTCAAACCTCCGCACCATTATCCGCGAGCTA
AAGTCAAGTCTTGCACCCACCGACACAGAGCAGTTCGACGAGGCGCGTTTGAGATACCGCCAAGTCCTCTCTCAA
ACCAAAAGGGTGAAACCAGAAGACTGGATCGTGGCTTGGAACAAGGCTAGGCTTGAAGGGGAGAAACATAAGATC
CCGGAGCTCCAAGGATACGCTGGAACCAGCGATTTCTTGACCGCAGTCACTACCTTTGATCCAGCTTGGGCCAAG
AACCAGATAGGCCAGGTTGCAGCCAACAGAAAGAGGAACCTTGACTCGGGATTCACGCTCCGCGAGCCCGAACTC
TTCCAAGAGGAGGTCCGCCGTACCAGGGCTGCTGCCAAGCTGACCGACAGTGTGTTCGCAGCCTCTGGAATGCAT
GACACCTCAGCCAATAGCCCCTGTCCGTGCGGATTACCTTCCTCCAAGCACTCCTGGAAAGCCAAGGACTGCGCA
GCTGTACAAATTGCAGTCAATGGTGCTTCTAAGGATGGAAGACAGGTTCGACCTACACGCCTGAAGATCTGCAAA
GAAGCCGTGAAGCTGGCCAAGTGGAAGAGCCTCGTTGACGCAGTCAAGGAATCTGGAGGTGACCTGCAGCAGACC
AACAGCCCGGAGGAGCCGCGGAAGCGAGGGGACTTTGTCGGTGTGGCCATCAGCGCTGAATGCCTCTCTGATGGA
ACTACAGAATCGGTCTTTGCAGCATTGCAGAAGCAGCATCCTCTTTACAACTCCACAATCTACGACGGAGGTGCA
ACCACACATGTCGTCAACAACAAGGACCTGCTAGCCGACATCAGGGAAGCGTCAGAGTCTGACCACATCATGATT
GGCGACAGCAGCCTCAAGATCCAGGCGAGAGGAACTCGAAGGATGGAAGACATACTTGATGGAGAGGACGGAAAG
AACACACGGGCACTTGTCTTGCTTGATGTGGCCTACGTTCCGCGATTCCACACCAACCTTTTCAGCGCAAAGAAG
CTTGAAAAGAAGGGCCTGTGGCACTGCGGATTTGACAACACGCTTCGAATGGGGACGTACGACGACAATGACGTG
CTTTGTCGGCTTACCGAAAAGTACGATCTCAAAATAGTCGAATACAAGCCTGTTGCACGCTCTTACTTCCAGCTT
CCACAACGGCCAATCTCCGTGTTCAATGCCTTCCAAGATGCCTTCTCATCCGTCCAGACGGAGAGCCTGCAGCCA
AGACCACGCCGGAGGATCGCAACATCAAGACAACCACCGCCTCCACGCTGGGACTCCGCTGAGATATGGCACCGT
CGAGCTTGCCACGCAGGGCCAAAAGCACTAGAACAACTTGTCTTACAGACAAGGGGAGTCCGCATTAAGGGCCCG
ACAACCGCCCAATGCACTGCTTGCGGCACTAGCAAAGCCACTGAGATTATCTCCCGCAGGGAATCACCGCACAGA
TCGAGACAACCGTTCTATCGGGTCTTCGTCGACATCTTCGGATTCTCTGCGGCCTACAACGGACACCGCTATATT
CTACTGATGACTGACGAGTATAGTGGCATGATGTTCTTTAGCTCCATGCCATCGAAGGCGGAAGCCACCAAGATC
GTTCAGGATTTTGACGCCCGCATTAAGAGACATACAGGAGCATCCCTTTGCAAAATCAGAGTCGACAACGAAAGG
GCGCTCGTTAATCTTCCACACCAGCGTGATTCTGAATTCCAGACCTGGGCAGCTGAGGAAGGAATGGAGATCGAA
CTTCCGCCGCCACACACCAAGGAACCAACAGGTGGCGCGGAGCGACCCGGTGGTATCAATCAGACACGAATGCGC
AGCATGGGGGGCCTTCTTCCCCTAGAACTCTGGCCAGAGTTCTACCGTGCAGCCGTCTGGATACATAACATCCTT
CCAAGCGAAGGAAACAAGTGGATGTCGCCTAAGGAGAAGATGGACCGCTGGTTCCACCAACACTTTCGATGGTAT
CGACCGCCAAACGTCGACTTTGATGCAACAAAGGACCACCGACCGCACTGGTGTGGGATTTACGCATACGGTTGC
AAAGCATATCCTTTGAATCCCCGCTACAAGGCTGGAAAGGACACCAATCTCTTCAAGCTTAGCCCACGAGCGCAC
GTTGGATACCTTGTTGGCTACCACGCCAGCAATATCTACCGCATCTGGGTCCCTAAGCTCAATCGGGTTATTCTA
ACTCGGGATGTACGATTCAACGAGGAAGAATTCTTCGATCCAGAAAAGGAGGACCAGTTGGAGACTGAGCGCATT
GCGGAATACGCTCCAATACTGCAAACGCATGAGCCGCTTCCAACACAAGACTGGGACTCCATCCTGAATGAGTTT
CTCTTCGAATTCGACCAAAATGTCCTGGGTATAAGCCCGGAGGGTTCGAACTCGGGGGTGGATGGCGATGGAGGA
ACCGTCACGGACGTCGCAGAGACCGTGCCACGAATCACGCAGTCTATGCAAACCCCATCTCAGAGACTTCTCACA
CCCCTGGGCGAATCCACAACAACTCTTCCCACACCGGATCCAACGCCACAGCTGGCAAGGAGGGACGCCTCCCCA
GCGCAACGTTCAGATTTCGGATCAGACACCCTAAGACTAGACCCGGCGTTGCAGCAGGCTTCGAGCTCCCCTGCC
CAACGAACCAAGGATGGTCCATGTACTAATTCAAGCACCTCAACACCAGATCCGGCGTTGCAGCAGACTGAGAGC
TCCCCTGCCCAACGAACCGAAGATGGTTTGAACGGTGATCCAGACAATTTCTTCTACCATGCTTCTGAAGCCTCT
CAATCCGAGTCACCAGCTCAGTCTGACCAACCGACTCGAGCGAAGAGAACAGAACAGGCTCAAAGATCAAGCGCT
CCCTCGCCCGAAGAGCTTGGAAGGGCCAATGAGCCAGAGGGCAGCCAGGAATGCGAAGATAGTCAAGGATCCACC
ACACCAGACGATCGTACCAGTCCTACCGAGGTCATCAAGGACACGATCGTATGCAAACCGCTGCCACCACCAGGC
GAGCAATCGGTGCAGCAGCAATCAGATGACCAACCAACTCCTGCCACGGCACAAAGCGAACCGCGCATTCGTCGC
CGCCGTCACCAGCGGGAACTTTACGGTGAACAGCCGACTCGCAAGAGTGCTCGGACACCGAAGCCAAACCGGAAG
ACCAATGACTACGCACACAGCGTTTTCACTGCCCTGCTTCCAACTGATAAACATCCTGAGGGAGACCTAGCGACA
TTTCACAGTGTTTTTCTCGCAGCAGTCTCCAAAGCCGCACGCGACCATCGGTTCCATCGAGATGACCTTGTGCGA
CTCCCGAAGAGGTACCAAGACCTTGAAAACCACCCCAAGGGACCCGAATTCAAGGAAGCTATTCGGAAAGAGCTG
CGTGATCTGCTCCAACGAGGCACGTGGAGGTTGATCGAACGCGAAAAGGCACATGGACCGCCTCTTCCACTGAAG
TGGGTGTTCACCTATAAGTTCGATCAAGATGGCTACCTCCAGAGGTGTAAGGCGCGCATCTGTGTCCGTGGAGAT
CTCCAAGAAGACGACGACGGACTAGAAACCTATGCAGCCACCCTCGCAGCAAAGACCTTCCGGATCGCCATGGCA
ACTGCAGCCGGATTCGACCTTGACATTAGACAATTTGACGTTGGCAACGCCTTCCTGTACAGCGACCTAAATAAG
GACCATCCCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail