Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8411
Gene name
LocationContig_548:6182..6652
Strand+
Gene length (bp)470
Transcript length (bp)315
Coding sequence length (bp)315
Protein length (aa) 105

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03647 Tmemb_14 Transmembrane proteins 14C 4.0E-23 7 94

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P47131|YJ55_YEAST TMEM14 protein homolog YJR085C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR085C PE=1 SV=1 3 102 2.0E-17
sp|Q75JB5|TM14_DICDI Transmembrane protein 14 homolog OS=Dictyostelium discoideum GN=DDB_G0271790 PE=3 SV=1 9 98 3.0E-15
sp|Q9P7G3|YK45_SCHPO TMEM14 protein homolog P14E8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP14E8.05c PE=3 SV=1 1 101 8.0E-11
sp|Q0P436|TM14C_DANRE Transmembrane protein 14C OS=Danio rerio GN=tmem14c PE=3 SV=1 1 82 1.0E-07

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 7 24 17
2 29 48 19
3 55 77 22
4 81 100 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8411
MQLDYSAYALAALTAGGGLMGYVRTRSTPSLVAGSAVGLLYGLGGYRLQNRQPYGIELGLLASVILGGSAIPRAI
RLRKPVPIVLSVLSAFGMVTFGNAYRQNL*
Coding >Hirsu2|8411
ATGCAGCTGGATTACTCGGCCTACGCGCTCGCGGCGCTGACGGCGGGAGGCGGCCTCATGGGCTACGTCAGGACG
CGGTCCACGCCTTCGCTCGTGGCCGGCTCCGCCGTCGGCCTGCTCTATGGTCTGGGTGGCTACCGGCTGCAGAAC
CGCCAGCCGTACGGCATCGAGCTGGGCCTGCTCGCCTCCGTCATCCTGGGTGGCTCCGCCATCCCGCGCGCCATC
CGCCTCAGGAAGCCCGTCCCTATCGTCCTCAGCGTCTTGTCGGCCTTTGGTATGGTGACTTTCGGCAACGCGTAC
CGACAGAATCTGTGA
Transcript >Hirsu2|8411
ATGCAGCTGGATTACTCGGCCTACGCGCTCGCGGCGCTGACGGCGGGAGGCGGCCTCATGGGCTACGTCAGGACG
CGGTCCACGCCTTCGCTCGTGGCCGGCTCCGCCGTCGGCCTGCTCTATGGTCTGGGTGGCTACCGGCTGCAGAAC
CGCCAGCCGTACGGCATCGAGCTGGGCCTGCTCGCCTCCGTCATCCTGGGTGGCTCCGCCATCCCGCGCGCCATC
CGCCTCAGGAAGCCCGTCCCTATCGTCCTCAGCGTCTTGTCGGCCTTTGGTATGGTGACTTTCGGCAACGCGTAC
CGACAGAATCTGTGA
Gene >Hirsu2|8411
ATGGTGCGTCTCGTCGCCACCCTCGCGGGCTGAGGGCACACAGGGCAGCGACGAGCTCGAGACTAACACGCAACG
TCGCCATCGCAGCAGCTGGATTACTCGGCCTACGCGCTCGCGGCGCTGACGGCGGGAGGCGGCCTCATGGGCTAC
GTCAGGACGCGGTCCACGCCTTCGCTCGTGGCCGGCTCCGCCGTCGGCCTGCTCTGTGCGTCTTTTCCCCTTGGC
CGTCCACCCTTCCTGCCCAGCCAGCCTCTCATTACTGATGATGGCGTCCAGATGGTCTGGGTGGCTACCGGCTGC
AGAACCGCCAGCCGTACGGCATCGAGCTGGGCCTGCTCGCCTCCGTCATCCTGGGTGGCTCCGCCATCCCGCGCG
CCATCCGCCTCAGGAAGCCCGTCCCTATCGTCCTCAGCGTCTTGTCGGCCTTTGGTATGGTGACTTTCGGCAACG
CGTACCGACAGAATCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail