Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8410
Gene name
LocationContig_548:5097..5757
Strand-
Gene length (bp)660
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02109 DAD DAD family 2.0E-50 49 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46967|DAD1_XENLA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1 OS=Xenopus laevis GN=dad1 PE=3 SV=1 58 154 2.0E-34
sp|Q5RBB4|DAD1_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Pongo abelii GN=DAD1 PE=3 SV=3 44 155 6.0E-33
sp|P61805|DAD1_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Rattus norvegicus GN=Dad1 PE=3 SV=3 44 155 1.0E-32
sp|P61804|DAD1_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Mus musculus GN=Dad1 PE=1 SV=3 44 155 1.0E-32
sp|P61806|DAD1_MESAU Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Mesocricetus auratus GN=DAD1 PE=3 SV=3 44 155 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46967|DAD1_XENLA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1 OS=Xenopus laevis GN=dad1 PE=3 SV=1 58 154 2.0E-34
sp|Q5RBB4|DAD1_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Pongo abelii GN=DAD1 PE=3 SV=3 44 155 6.0E-33
sp|P61805|DAD1_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Rattus norvegicus GN=Dad1 PE=3 SV=3 44 155 1.0E-32
sp|P61804|DAD1_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Mus musculus GN=Dad1 PE=1 SV=3 44 155 1.0E-32
sp|P61806|DAD1_MESAU Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Mesocricetus auratus GN=DAD1 PE=3 SV=3 44 155 1.0E-32
sp|P61803|DAD1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Homo sapiens GN=DAD1 PE=1 SV=3 44 155 1.0E-32
sp|Q29036|DAD1_PIG Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Sus scrofa GN=DAD1 PE=3 SV=3 44 155 1.0E-32
sp|Q5E9C2|DAD1_BOVIN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Bos taurus GN=DAD1 PE=3 SV=3 44 155 1.0E-32
sp|P52872|DAD1_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1 OS=Caenorhabditis elegans GN=dad-1 PE=3 SV=1 50 154 2.0E-31
sp|Q9VLM5|DAD1_DROME Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Drosophila melanogaster GN=l(2)k12914 PE=3 SV=1 50 154 1.0E-30
sp|O13113|DAD1_CHICK Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Gallus gallus GN=DAD1 PE=2 SV=1 37 155 3.0E-29
sp|Q8I7Z2|DAD1_ARAVE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Araneus ventricosus GN=DAD1 PE=2 SV=1 49 154 3.0E-29
sp|Q54FB6|DAD1_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Dictyostelium discoideum GN=ost2 PE=3 SV=1 34 154 6.0E-27
sp|P46964|OST2_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST2 PE=1 SV=3 32 155 3.0E-24
sp|O24060|DAD1_MALDO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Malus domestica GN=DAD1 PE=3 SV=1 33 154 7.0E-24
sp|Q9M3T9|DAD1_BETPN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Betula pendula GN=DAD1 PE=3 SV=1 40 154 1.0E-23
sp|Q39080|DAD1_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Arabidopsis thaliana GN=DAD1 PE=2 SV=2 41 154 2.0E-23
sp|O22622|DAD2_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2 OS=Arabidopsis thaliana GN=DAD2 PE=2 SV=1 41 154 3.0E-23
sp|O65085|DAD1_PICMA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Picea mariana GN=DAD1 PE=3 SV=1 62 154 4.0E-23
sp|Q9SME8|DAD2_HORVU Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2 OS=Hordeum vulgare GN=DAD2 PE=3 SV=1 44 154 8.0E-23
sp|Q9SME9|DAD1_HORVU Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Hordeum vulgare GN=DAD1 PE=3 SV=1 43 154 2.0E-22
sp|Q9ZWQ7|DAD1_CITUN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Citrus unshiu GN=DAD1 PE=3 SV=1 62 154 3.0E-22
sp|Q0JDK9|DAD1_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Oryza sativa subsp. japonica GN=DAD1 PE=3 SV=1 62 154 4.0E-22
sp|A2XSY1|DAD1_ORYSI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Oryza sativa subsp. indica GN=DAD1 PE=3 SV=1 62 154 4.0E-22
sp|Q9SMC4|DAD1_SOLLC Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Solanum lycopersicum GN=DAD1 PE=3 SV=1 62 154 5.0E-22
sp|O14238|OST2_SCHPO Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ost2 PE=3 SV=1 58 155 6.0E-22
sp|Q9ZRA3|DAD1_PEA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Pisum sativum GN=DAD1 PE=3 SV=1 62 154 9.0E-22
sp|O81214|DAD1_MAIZE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (Fragment) OS=Zea mays GN=DAD1 PE=2 SV=2 77 154 6.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004579 dolichyl-diphosphooligosaccharide-protein glycotransferase activity Yes
GO:0008250 oligosaccharyltransferase complex Yes
GO:0044446 intracellular organelle part No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:1990234 transferase complex No
GO:0044424 intracellular part No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:0003824 catalytic activity No
GO:0044432 endoplasmic reticulum part No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0004576 oligosaccharyl transferase activity No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0098796 membrane protein complex No
GO:1902494 catalytic complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 135 154 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8410
MAPKKNAREPTPSSAATSQAGVTAAGSVPPQPKQSASSSGRAGAANWDQVLRNIHQYYMKETPQRTKLIDAFLAF
LVVVGVVQFLYCVLAGNYPFNAFLSGFCATVGQFVLTVSLRSQTTESNKSDFSAVSPERAFADYVVCSLVLHFFC
VNFIN*
Coding >Hirsu2|8410
ATGGCGCCCAAGAAGAACGCACGCGAGCCGACGCCCTCGTCCGCGGCGACCTCCCAGGCCGGCGTCACGGCCGCC
GGCTCCGTCCCGCCGCAGCCCAAGCAGTCGGCCTCGTCGTCGGGCCGGGCGGGCGCCGCCAACTGGGACCAGGTC
CTGCGCAACATCCACCAGTATTACATGAAGGAGACGCCGCAGCGCACCAAGCTGATCGACGCCTTCCTCGCCTTT
CTCGTCGTCGTCGGCGTCGTGCAGTTCCTCTACTGCGTTCTGGCCGGCAATTACCCGTTCAACGCCTTCCTCTCC
GGCTTCTGCGCAACGGTCGGCCAATTCGTTCTGACGGTCTCCTTACGAAGCCAGACAACCGAATCCAACAAGAGC
GACTTCTCCGCCGTGTCCCCAGAGAGAGCCTTTGCCGACTACGTCGTGTGCAGTCTCGTGCTGCATTTCTTCTGC
GTCAACTTCATCAACTAG
Transcript >Hirsu2|8410
ATGGCGCCCAAGAAGAACGCACGCGAGCCGACGCCCTCGTCCGCGGCGACCTCCCAGGCCGGCGTCACGGCCGCC
GGCTCCGTCCCGCCGCAGCCCAAGCAGTCGGCCTCGTCGTCGGGCCGGGCGGGCGCCGCCAACTGGGACCAGGTC
CTGCGCAACATCCACCAGTATTACATGAAGGAGACGCCGCAGCGCACCAAGCTGATCGACGCCTTCCTCGCCTTT
CTCGTCGTCGTCGGCGTCGTGCAGTTCCTCTACTGCGTTCTGGCCGGCAATTACCCGTTCAACGCCTTCCTCTCC
GGCTTCTGCGCAACGGTCGGCCAATTCGTTCTGACGGTCTCCTTACGAAGCCAGACAACCGAATCCAACAAGAGC
GACTTCTCCGCCGTGTCCCCAGAGAGAGCCTTTGCCGACTACGTCGTGTGCAGTCTCGTGCTGCATTTCTTCTGC
GTCAACTTCATCAACTAG
Gene >Hirsu2|8410
ATGGCGCCCAAGAAGAACGCACGCGAGCCGACGCCCTCGTCCGCGGCGACCTCCCAGGCCGGCGTCACGGCCGCC
GGCTCCGTCCCGCCGCAGCCCAAGCAGTCGGCCTCGTCGTCGGGCCGGGCGGGCGCCGCCAACTGGGACCAGGTC
CTGCGCAACATCCACCAGTATTACATGAAGGAGACGCCGCAGCGCACCAAGCTGATCGACGCCTTCCTCGCCTTT
CTCGTCGTCGTCGGCGTCGTGCAGTTCCTCTACTGCGTTCTGGCCGGCAATTACGTGCGTGCCCTGGGCCGGGAG
TCGCCAGCGCCTGTCGAGCTGACATGCACTGCTGCAGCCGTTCAACGCCTTCCTCTCCGGCTTCTGCGCAACGGT
CGGCCAATTCGTTCTGACGGGTATGTGCCACGCACTTTCGACTGGCTCCCTCCCTCGACACGGGCGCTCACACGC
GTCCTTCCAGTCTCCTTACGAAGCCAGACAACCGAATCCAACAAGAGCGACTTCTCCGCCGTGTCCCCAGAGAGG
TCAGGCCCCAGGCCCAGTCCTCTACCGTACCACAAGTCTCGAGTGCTCACTGTCTTTGCCTTTCACAGAGCCTTT
GCCGACTACGTCGTGTGCAGTCTCGTGCTGCATTTCTTCTGCGTCAACTTCATCAACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail