Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8407
Gene name
LocationContig_548:352..1047
Strand-
Gene length (bp)695
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13418 Kelch_4 Galactose oxidase, central domain 6.1E-10 83 129
PF13415 Kelch_3 Galactose oxidase, central domain 3.8E-08 90 139

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 20 153 1.0E-17
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 20 153 1.0E-15
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 20 153 7.0E-15
sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 33 153 7.0E-14
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 66 152 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 20 153 1.0E-17
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 20 153 1.0E-15
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 20 153 7.0E-15
sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 33 153 7.0E-14
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 66 152 1.0E-06
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 21 152 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8407
MAKDKKKSADSKKAKKAEKAAKQASKGEKKAKNKAAKLDGSDAEDVDLDEVLEEYRRQQEQFLKVTETVCEGPPR
PRAASTLMATPHDSNSLLLFGGEYFNGSLAQFYNDLHIYNIGRDEWRCVTSPNTPLPRSGHAWTRASNPSHVYLF
GGEARTGARRRGAATG*
Coding >Hirsu2|8407
ATGGCCAAAGACAAGAAGAAGAGCGCGGACTCGAAGAAGGCGAAGAAGGCCGAGAAGGCGGCCAAGCAGGCCAGC
AAGGGCGAGAAGAAGGCCAAGAACAAGGCGGCCAAGCTGGACGGCAGCGACGCCGAGGATGTCGACCTGGACGAG
GTGCTCGAGGAGTACCGCCGGCAGCAGGAGCAGTTCCTCAAGGTGACGGAGACGGTGTGCGAGGGCCCGCCGCGG
CCGCGGGCGGCGTCGACGCTGATGGCGACGCCGCACGACAGCAACAGCCTGCTGCTGTTCGGCGGCGAGTACTTC
AACGGCTCGCTGGCGCAGTTCTACAACGACCTGCACATCTACAACATCGGCCGCGACGAGTGGCGCTGCGTCACG
TCGCCCAACACGCCGCTGCCGCGCTCCGGCCACGCCTGGACCCGGGCCAGCAACCCGAGCCACGTCTACCTCTTC
GGCGGCGAGGCAAGGACCGGAGCCCGCCGGCGAGGAGCGGCCACCGGATGA
Transcript >Hirsu2|8407
ATGGCCAAAGACAAGAAGAAGAGCGCGGACTCGAAGAAGGCGAAGAAGGCCGAGAAGGCGGCCAAGCAGGCCAGC
AAGGGCGAGAAGAAGGCCAAGAACAAGGCGGCCAAGCTGGACGGCAGCGACGCCGAGGATGTCGACCTGGACGAG
GTGCTCGAGGAGTACCGCCGGCAGCAGGAGCAGTTCCTCAAGGTGACGGAGACGGTGTGCGAGGGCCCGCCGCGG
CCGCGGGCGGCGTCGACGCTGATGGCGACGCCGCACGACAGCAACAGCCTGCTGCTGTTCGGCGGCGAGTACTTC
AACGGCTCGCTGGCGCAGTTCTACAACGACCTGCACATCTACAACATCGGCCGCGACGAGTGGCGCTGCGTCACG
TCGCCCAACACGCCGCTGCCGCGCTCCGGCCACGCCTGGACCCGGGCCAGCAACCCGAGCCACGTCTACCTCTTC
GGCGGCGAGGCAAGGACCGGAGCCCGCCGGCGAGGAGCGGCCACCGGATGA
Gene >Hirsu2|8407
ATGGCCAAAGACAAGAAGAAGAGCGCGGACTCGAAGAAGGCGAAGAAGGTGAGACAGAGACAGGGCCTCGAGTCG
TGGGCGACACGGTGACACGGCATGGGAACCCTTGACGGAGATTGTATTGACAGATGATGCCTCCACCATCCAGGC
CGAGAAGGCGGCCAAGCAGGCCAGCAAGGGCGAGAAGAAGGCCAAGAACAAGGCGGCCAAGCTGGACGGCAGCGA
CGCCGAGGATGTCGACCTGGACGAGGTGCTCGAGGAGTACCGCCGGCAGCAGGAGCAGTTCCTCAAGGTGACGGA
GACGGTGTGCGAGGGCCCGCCGCGGCCGCGGGCGGCGTCGACGCTGATGGCGACGCCGCACGACAGCAACAGCCT
GCTGCTGTTCGGCGGCGAGTACTTCAACGGCTCGCTGGCGCAGTTCTACAACGACCTGCACATCTACAACATCGG
CCGCGACGAGTGGCGCTGCGTCACGTCGCCCAACACGCCGCTGCCGCGCTCCGGCCACGCCTGGACCCGGGCCAG
CAACCCGAGCCACGTCTACCTCTTCGGCGGCGAGTTCTCCTCGCCCAAGCAGGGCACCTTCCACCACTACTCGGA
CTTCTGGAGGCTCGAGCCGGCCACGCGCGAGTGGACCAAGATCGAGGTCAAGGGCAAGGACCGGAGCCCGCCGGC
GAGGAGCGGCCACCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail