Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8406
Gene name
LocationContig_547:14064..15440
Strand+
Gene length (bp)1376
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain 1.2E-37 47 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13769|ULP2_SCHPO Ubiquitin-like-specific protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ulp2 PE=1 SV=2 23 269 5.0E-45
sp|A7MBJ2|SENP7_BOVIN Sentrin-specific protease 7 OS=Bos taurus GN=SENP7 PE=2 SV=1 10 265 7.0E-31
sp|D3ZF42|SENP7_RAT Sentrin-specific protease 7 OS=Rattus norvegicus GN=Senp7 PE=1 SV=1 9 265 7.0E-31
sp|Q8BUH8|SENP7_MOUSE Sentrin-specific protease 7 OS=Mus musculus GN=Senp7 PE=1 SV=1 20 265 1.0E-30
sp|Q9BQF6|SENP7_HUMAN Sentrin-specific protease 7 OS=Homo sapiens GN=SENP7 PE=1 SV=4 10 265 9.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13769|ULP2_SCHPO Ubiquitin-like-specific protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ulp2 PE=1 SV=2 23 269 5.0E-45
sp|A7MBJ2|SENP7_BOVIN Sentrin-specific protease 7 OS=Bos taurus GN=SENP7 PE=2 SV=1 10 265 7.0E-31
sp|D3ZF42|SENP7_RAT Sentrin-specific protease 7 OS=Rattus norvegicus GN=Senp7 PE=1 SV=1 9 265 7.0E-31
sp|Q8BUH8|SENP7_MOUSE Sentrin-specific protease 7 OS=Mus musculus GN=Senp7 PE=1 SV=1 20 265 1.0E-30
sp|Q9BQF6|SENP7_HUMAN Sentrin-specific protease 7 OS=Homo sapiens GN=SENP7 PE=1 SV=4 10 265 9.0E-30
sp|Q9P0U3|SENP1_HUMAN Sentrin-specific protease 1 OS=Homo sapiens GN=SENP1 PE=1 SV=2 32 226 6.0E-21
sp|Q5RBB1|SENP1_PONAB Sentrin-specific protease 1 OS=Pongo abelii GN=SENP1 PE=2 SV=1 32 226 7.0E-21
sp|P59110|SENP1_MOUSE Sentrin-specific protease 1 OS=Mus musculus GN=Senp1 PE=2 SV=1 32 226 1.0E-20
sp|Q9HC62|SENP2_HUMAN Sentrin-specific protease 2 OS=Homo sapiens GN=SENP2 PE=1 SV=3 35 226 2.0E-20
sp|Q5R7K7|SENP2_PONAB Sentrin-specific protease 2 OS=Pongo abelii GN=SENP2 PE=2 SV=1 35 226 8.0E-20
sp|Q8L7S0|ULP2B_ARATH Probable ubiquitin-like-specific protease 2B OS=Arabidopsis thaliana GN=ULP2B PE=1 SV=3 23 224 1.0E-19
sp|P40537|ULP2_YEAST Ubiquitin-like-specific protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULP2 PE=1 SV=1 19 227 2.0E-19
sp|Q8RWN0|ULP1C_ARATH Ubiquitin-like-specific protease 1C OS=Arabidopsis thaliana GN=ULP1C PE=1 SV=1 27 260 2.0E-19
sp|Q91ZX6|SENP2_MOUSE Sentrin-specific protease 2 OS=Mus musculus GN=Senp2 PE=1 SV=2 35 226 5.0E-19
sp|Q9GZR1|SENP6_HUMAN Sentrin-specific protease 6 OS=Homo sapiens GN=SENP6 PE=1 SV=2 26 130 1.0E-18
sp|Q2PS26|ULP1D_ARATH Ubiquitin-like-specific protease 1D OS=Arabidopsis thaliana GN=ULP1D PE=1 SV=1 39 260 2.0E-18
sp|Q6P7W0|SENP6_MOUSE Sentrin-specific protease 6 OS=Mus musculus GN=Senp6 PE=1 SV=3 26 130 2.0E-18
sp|Q94F30|ESD4_ARATH Ubiquitin-like-specific protease ESD4 OS=Arabidopsis thaliana GN=ESD4 PE=1 SV=1 48 223 3.0E-18
sp|Q9EQE1|SENP2_RAT Sentrin-specific protease 2 OS=Rattus norvegicus GN=Senp2 PE=1 SV=1 35 226 4.0E-18
sp|Q09353|SENP_CAEEL Sentrin-specific protease OS=Caenorhabditis elegans GN=ulp-1 PE=2 SV=3 39 221 2.0E-17
sp|Q0WKV8|ULP2A_ARATH Probable ubiquitin-like-specific protease 2A OS=Arabidopsis thaliana GN=ULP2A PE=2 SV=2 23 224 9.0E-17
sp|Q6NXL6|SENP5_MOUSE Sentrin-specific protease 5 OS=Mus musculus GN=Senp5 PE=2 SV=1 31 221 2.0E-16
sp|Q96HI0|SENP5_HUMAN Sentrin-specific protease 5 OS=Homo sapiens GN=SENP5 PE=1 SV=3 31 221 3.0E-16
sp|O65278|ULP1B_ARATH Putative ubiquitin-like-specific protease 1B OS=Arabidopsis thaliana GN=ULP1B PE=5 SV=2 35 223 3.0E-16
sp|Q8WP32|SENP5_MACFA Sentrin-specific protease 5 OS=Macaca fascicularis GN=SENP5 PE=2 SV=1 31 221 4.0E-16
sp|Q8GYL3|ULP1A_ARATH Ubiquitin-like-specific protease 1A OS=Arabidopsis thaliana GN=ULP1A PE=2 SV=2 43 223 9.0E-15
sp|Q9EP97|SENP3_MOUSE Sentrin-specific protease 3 OS=Mus musculus GN=Senp3 PE=1 SV=1 32 223 9.0E-15
sp|Q9H4L4|SENP3_HUMAN Sentrin-specific protease 3 OS=Homo sapiens GN=SENP3 PE=1 SV=2 32 223 1.0E-14
sp|Q9GZR1|SENP6_HUMAN Sentrin-specific protease 6 OS=Homo sapiens GN=SENP6 PE=1 SV=2 143 292 5.0E-10
sp|Q6P7W0|SENP6_MOUSE Sentrin-specific protease 6 OS=Mus musculus GN=Senp6 PE=1 SV=3 143 267 1.0E-09
sp|Q09275|ULP4_CAEEL Ubiquitin-like protease 4 OS=Caenorhabditis elegans GN=ulp-4 PE=2 SV=2 39 227 3.0E-09
sp|Q02724|ULP1_YEAST Ubiquitin-like-specific protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULP1 PE=1 SV=1 35 216 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008234 cysteine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4265 0.845 0.2073 0.0533 0.0551 0.0021 0.0881 0.0604 0.038 0.0118

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4148
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2633
Ophiocordyceps australis map64 (Brazil) OphauB2|5529
Ophiocordyceps camponoti-floridani Ophcf2|00590
Ophiocordyceps camponoti-rufipedis Ophun1|7393
Ophiocordyceps kimflemingae Ophio5|7716
Ophiocordyceps subramaniannii Hirsu2|8406 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8406
MDIAPDGWTSQNPEWRNQWQRSLVFPATGKNRTTVDADDIPRLDEGQFLNDNIINFYLRYLQCQLEKERPELLEK
VYIFSTFFLEKLRLPRGKINYDGVKAWTAKFDLFSYDYIIVPVNEHLHWYLAIICNVPSTLHGISKQTSSAGAQK
LHPKQPKILTLDSLGQGRPLTCKNLKDYLAEEAKNKKGADLAMIPNGMTARDIPKQNNHCDCGAFVLGYVEEFLK
DPNGVARKLLRKENVEWNIQPSTLRDKVRSLLFKLQGEQQSRLESEKEEKRKSAAMKKVAKQEKTEQPRLEEILD
TLPAQALPESGPAQNAGDPPATENRTQKQTEENGLGELLPIPAEISRPSQEQDDDEVTFVKALQNIPERRAFEER
DPLRREVDNGGTPDFQESHFT*
Coding >Hirsu2|8406
ATGGATATCGCTCCCGATGGCTGGACCAGTCAAAACCCTGAGTGGCGAAATCAGTGGCAGCGATCCCTCGTGTTT
CCGGCTACGGGGAAGAACAGGACGACGGTAGACGCCGATGACATCCCTAGACTCGACGAGGGACAATTTCTGAAC
GACAACATCATCAATTTCTACTTGCGCTACCTGCAATGCCAGCTCGAGAAGGAAAGGCCGGAGCTTCTGGAGAAG
GTCTACATCTTCAGTACTTTCTTCTTGGAGAAGCTGAGACTTCCCAGGGGTAAGATCAACTACGACGGCGTCAAG
GCCTGGACAGCCAAATTCGATCTCTTCTCTTACGACTACATCATTGTGCCCGTCAACGAACATTTACACTGGTAC
CTGGCGATTATTTGCAACGTGCCGAGCACTCTCCATGGCATCAGCAAGCAGACCTCGAGCGCCGGAGCACAGAAG
TTGCACCCAAAGCAGCCCAAAATCCTGACTCTGGACTCTCTTGGCCAGGGGCGCCCTCTCACCTGCAAGAATCTG
AAGGACTATTTGGCCGAGGAGGCAAAGAACAAGAAGGGCGCGGACCTAGCCATGATTCCTAATGGGATGACGGCC
AGAGACATCCCCAAACAGAATAATCACTGCGACTGCGGGGCTTTCGTGCTGGGGTACGTAGAGGAGTTCCTCAAG
GACCCCAATGGTGTCGCCCGCAAACTACTTCGCAAGGAAAACGTCGAATGGAACATACAGCCCTCAACATTGCGA
GATAAGGTTCGGTCGTTACTTTTCAAGCTTCAGGGAGAGCAGCAGTCGCGACTCGAGAGCGAGAAAGAGGAGAAG
CGCAAGTCTGCTGCCATGAAGAAGGTGGCGAAACAGGAGAAGACTGAGCAACCCCGACTCGAAGAAATTCTTGAC
ACATTGCCCGCCCAAGCTTTACCCGAGAGCGGACCCGCGCAGAACGCCGGAGATCCTCCGGCGACCGAAAACAGG
ACACAGAAACAGACAGAGGAGAACGGGCTGGGGGAGTTACTCCCTATCCCTGCCGAGATCAGCCGCCCGTCTCAA
GAACAGGATGACGACGAGGTGACATTCGTCAAGGCCCTTCAAAACATCCCCGAGCGACGAGCCTTTGAAGAACGG
GACCCCCTACGCCGCGAAGTCGATAATGGAGGAACACCAGACTTCCAAGAAAGCCATTTCACATGA
Transcript >Hirsu2|8406
ATGGATATCGCTCCCGATGGCTGGACCAGTCAAAACCCTGAGTGGCGAAATCAGTGGCAGCGATCCCTCGTGTTT
CCGGCTACGGGGAAGAACAGGACGACGGTAGACGCCGATGACATCCCTAGACTCGACGAGGGACAATTTCTGAAC
GACAACATCATCAATTTCTACTTGCGCTACCTGCAATGCCAGCTCGAGAAGGAAAGGCCGGAGCTTCTGGAGAAG
GTCTACATCTTCAGTACTTTCTTCTTGGAGAAGCTGAGACTTCCCAGGGGTAAGATCAACTACGACGGCGTCAAG
GCCTGGACAGCCAAATTCGATCTCTTCTCTTACGACTACATCATTGTGCCCGTCAACGAACATTTACACTGGTAC
CTGGCGATTATTTGCAACGTGCCGAGCACTCTCCATGGCATCAGCAAGCAGACCTCGAGCGCCGGAGCACAGAAG
TTGCACCCAAAGCAGCCCAAAATCCTGACTCTGGACTCTCTTGGCCAGGGGCGCCCTCTCACCTGCAAGAATCTG
AAGGACTATTTGGCCGAGGAGGCAAAGAACAAGAAGGGCGCGGACCTAGCCATGATTCCTAATGGGATGACGGCC
AGAGACATCCCCAAACAGAATAATCACTGCGACTGCGGGGCTTTCGTGCTGGGGTACGTAGAGGAGTTCCTCAAG
GACCCCAATGGTGTCGCCCGCAAACTACTTCGCAAGGAAAACGTCGAATGGAACATACAGCCCTCAACATTGCGA
GATAAGGTTCGGTCGTTACTTTTCAAGCTTCAGGGAGAGCAGCAGTCGCGACTCGAGAGCGAGAAAGAGGAGAAG
CGCAAGTCTGCTGCCATGAAGAAGGTGGCGAAACAGGAGAAGACTGAGCAACCCCGACTCGAAGAAATTCTTGAC
ACATTGCCCGCCCAAGCTTTACCCGAGAGCGGACCCGCGCAGAACGCCGGAGATCCTCCGGCGACCGAAAACAGG
ACACAGAAACAGACAGAGGAGAACGGGCTGGGGGAGTTACTCCCTATCCCTGCCGAGATCAGCCGCCCGTCTCAA
GAACAGGATGACGACGAGGTGACATTCGTCAAGGCCCTTCAAAACATCCCCGAGCGACGAGCCTTTGAAGAACGG
GACCCCCTACGCCGCGAAGTCGATAATGGAGGAACACCAGACTTCCAAGAAAGCCATTTCACATGA
Gene >Hirsu2|8406
ATGGATATCGCTCCCGATGGCTGGACCAGTCAAAACCCTGAGTGGCGAAATCAGTGGCAGCGATCCCTCGTGTTT
CCGGCTACGGGGAAGAACAGGACGACGGTAGACGCCGATGACATCCCTAGACTCGACGAGGGACAATTTCTGAAC
GACAACATCATCAATTTCTACTTGCGCTACCTGCAATGCCAGCTCGAGAAGGAAAGGCCGGAGCTTCTGGAGAAG
GTCTACATCTTCAGTACTTTCTTCTTGGAGAAGCTGAGACTTCCCAGGGGTAAGATCAACTACGACGGCGTCAAG
GCCTGGACAGCCAAATTCGATCTCTTCTCTTACGACTACATCATTGTGCCCGTCAACGAACATTTACACTGGTAC
CTGGCGATTATTTGCAACGTGCCGAGCACTCTCCATGGTCTGCCGGCTCCAGCCGACGTTGAGATGATCGATGTG
TCACAGGAGCTCGACACTCGTACTACCGCTGTGCAGACTTCCTTGAGCCAGCCGGTGGGGTCGCCACTTGCCAAC
AATGGCAGTAACAAACAAACCCCAGGCATCAGCAAGCAGACCTCGAGCGCCGGAGCACAGAAGTTGCACCCAAAG
CAGCCCAAAATCCTGACTCTGGACTCTCTTGGCCAGGGGCGCCCTCTCACCTGCAAGAATCTGAAGGACTATTTG
GCCGAGGAGGCAAAGAACAAGAAGGGCGCGGACCTAGCCATGATTCCTAATGGGATGACGGCCAGAGACATCCCC
AAACAGAATAATCACTGCGACTGCGGGGCTTTCGTGCTGGGGTACGTAGAGGAGTTCCTCAAGGACCCCAATGGT
GTCGCCCGCAAACTACTTCGCAAGGAAAACGTCGAATGGAACATACAGCCCTCAACATTGCGAGATAAGGTTCGG
TCGTTACTTTTCAAGCTTCAGGGAGAGCAGCAGTCGCGACTCGAGAGCGAGAAAGAGGAGAAGCGCAAGTCTGCT
GCCATGAAGAAGGTGGCGAAACAGGAGAAGACTGAGCAACCCCGACTCGAAGAAATTCTTGACACATTGCCCGCC
CAAGCTTTACCCGAGAGCGGACCCGCGCAGAACGCCGGAGATCCTCCGGCGACCGAAAACAGGACACAGAAACAG
ACAGAGGAGAACGGGCTGGGGGAGTTACTCCCTATCCCTGCCGAGATCAGCCGCCCGTCTCAAGAACAGGATGAC
GACGAGGTGACATTCGTCAAGGCCCTTCAAAGTGACTCGAGCAGGAGTACCCCGAAGCAGGTATTTTACTCGGCA
CAGACATCCCCGAGCGACGAGCCTTTGAAGAACGGGACCCCCTACGCCGCGAAGTCGATAATGGAGGAACACCAG
ACTTCCAAGAAAGCCATTTCACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail