Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8404
Gene name
LocationContig_547:4773..8627
Strand+
Gene length (bp)3854
Transcript length (bp)3561
Coding sequence length (bp)3561
Protein length (aa) 1187

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17846 XRN_M Xrn1 helical domain 4.4E-98 276 681
PF03159 XRN_N XRN 5'-3' exonuclease N-terminus 2.7E-97 1 228
PF18332 XRN1_D1 Exoribonuclease Xrn1 D1 domain 4.8E-72 732 920
PF18334 XRN1_D2_D3 Exoribonuclease Xrn1 D2/D3 domain 1.0E-33 924 1009
PF18194 Xrn1_D3 Exoribonuclease 1 Domain-3 4.5E-07 1092 1159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22147|XRN1_YEAST 5'-3' exoribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XRN1 PE=1 SV=1 1 1174 0.0E+00
sp|P40383|XRN1_SCHPO 5'-3' exoribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo2 PE=1 SV=1 1 1174 0.0E+00
sp|Q8IZH2|XRN1_HUMAN 5'-3' exoribonuclease 1 OS=Homo sapiens GN=XRN1 PE=1 SV=1 1 1121 0.0E+00
sp|P97789|XRN1_MOUSE 5'-3' exoribonuclease 1 OS=Mus musculus GN=Xrn1 PE=1 SV=1 1 1121 0.0E+00
sp|Q5BFH3|XRN2_EMENI 5'-3' exoribonuclease 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rat1 PE=3 SV=3 1 683 2.0E-145
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22147|XRN1_YEAST 5'-3' exoribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XRN1 PE=1 SV=1 1 1174 0.0E+00
sp|P40383|XRN1_SCHPO 5'-3' exoribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo2 PE=1 SV=1 1 1174 0.0E+00
sp|Q8IZH2|XRN1_HUMAN 5'-3' exoribonuclease 1 OS=Homo sapiens GN=XRN1 PE=1 SV=1 1 1121 0.0E+00
sp|P97789|XRN1_MOUSE 5'-3' exoribonuclease 1 OS=Mus musculus GN=Xrn1 PE=1 SV=1 1 1121 0.0E+00
sp|Q5BFH3|XRN2_EMENI 5'-3' exoribonuclease 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rat1 PE=3 SV=3 1 683 2.0E-145
sp|Q5ZIP4|XRN2_CHICK 5'-3' exoribonuclease 2 OS=Gallus gallus GN=XRN2 PE=2 SV=1 1 689 1.0E-143
sp|Q8TFZ1|XRN2_ASPFU 5'-3' exoribonuclease 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rat1 PE=3 SV=4 1 683 2.0E-141
sp|Q5AMG5|XRN2_CANAL 5'-3' exoribonuclease 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAT1 PE=3 SV=3 1 680 1.0E-139
sp|Q02792|XRN2_YEAST 5'-3' exoribonuclease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAT1 PE=1 SV=3 1 696 7.0E-139
sp|Q6BNU7|XRN2_DEBHA 5'-3' exoribonuclease 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAT1 PE=3 SV=4 1 696 1.0E-136
sp|Q2GNZ6|XRN2_CHAGB 5'-3' exoribonuclease 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RAT1 PE=3 SV=3 1 711 2.0E-136
sp|Q6CKX0|XRN2_KLULA 5'-3' exoribonuclease 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAT1 PE=3 SV=3 1 680 1.0E-135
sp|Q9FQ02|XRN2_ARATH 5'-3' exoribonuclease 2 OS=Arabidopsis thaliana GN=XRN2 PE=2 SV=1 1 681 2.0E-135
sp|Q9FQ03|XRN3_ARATH 5'-3' exoribonuclease 3 OS=Arabidopsis thaliana GN=XRN3 PE=2 SV=1 1 680 2.0E-135
sp|Q4HWE2|XRN2_GIBZE 5'-3' exoribonuclease 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAT1 PE=3 SV=3 1 683 1.0E-132
sp|P40848|XRN2_SCHPO 5'-3' exoribonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dhp1 PE=1 SV=1 1 688 3.0E-130
sp|Q9DBR1|XRN2_MOUSE 5'-3' exoribonuclease 2 OS=Mus musculus GN=Xrn2 PE=1 SV=1 1 798 6.0E-130
sp|Q9H0D6|XRN2_HUMAN 5'-3' exoribonuclease 2 OS=Homo sapiens GN=XRN2 PE=1 SV=1 1 798 2.0E-129
sp|Q8WZX5|XRN2_NEUCR 5'-3' exoribonuclease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=exr-1 PE=3 SV=3 1 683 3.0E-128
sp|Q6C961|XRN2_YARLI 5'-3' exoribonuclease 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAT1 PE=3 SV=3 1 680 5.0E-127
sp|Q5R4L5|XRN2_PONAB 5'-3' exoribonuclease 2 OS=Pongo abelii GN=XRN2 PE=2 SV=1 1 798 2.0E-125
sp|Q9U299|XRN2_CAEEL 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis elegans GN=xrn-2 PE=1 SV=2 1 371 3.0E-93
sp|Q60SG7|XRN2_CAEBR 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis briggsae GN=xrn-2 PE=3 SV=2 1 371 2.0E-92
sp|Q9VM71|XRN2_DROME 5'-3' exoribonuclease 2 homolog OS=Drosophila melanogaster GN=Rat1 PE=1 SV=2 1 377 6.0E-90
sp|Q74ZA0|XRN2_ASHGO 5'-3' exoribonuclease 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAT1 PE=3 SV=4 1 391 1.0E-86
sp|Q6FKN6|XRN2_CANGA 5'-3' exoribonuclease 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAT1 PE=3 SV=3 1 399 1.0E-83
sp|Q2UCP5|XRN2_ASPOR 5'-3' exoribonuclease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rat1 PE=3 SV=3 1 362 1.0E-83
sp|P0CL88|XRN2_CRYNJ 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAT1 PE=3 SV=1 1 362 5.0E-82
sp|P0CL89|XRN2_CRYNB 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAT1 PE=3 SV=1 1 362 6.0E-82
sp|Q4P149|XRN2_USTMA 5'-3' exoribonuclease 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAT1 PE=3 SV=3 1 350 2.0E-81
sp|Q9FQ04|XRN4_ARATH 5'-3' exoribonuclease 4 OS=Arabidopsis thaliana GN=XRN4 PE=2 SV=1 1 386 6.0E-80
sp|Q2UCP5|XRN2_ASPOR 5'-3' exoribonuclease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rat1 PE=3 SV=3 516 683 2.0E-46
sp|Q4P149|XRN2_USTMA 5'-3' exoribonuclease 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAT1 PE=3 SV=3 502 683 2.0E-43
sp|Q74ZA0|XRN2_ASHGO 5'-3' exoribonuclease 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAT1 PE=3 SV=4 517 680 1.0E-42
sp|Q6FKN6|XRN2_CANGA 5'-3' exoribonuclease 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAT1 PE=3 SV=3 498 696 8.0E-42
sp|Q9FQ04|XRN4_ARATH 5'-3' exoribonuclease 4 OS=Arabidopsis thaliana GN=XRN4 PE=2 SV=1 517 680 6.0E-41
sp|P0CL88|XRN2_CRYNJ 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAT1 PE=3 SV=1 517 688 3.0E-40
sp|P0CL89|XRN2_CRYNB 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAT1 PE=3 SV=1 517 688 3.0E-40
sp|Q9VM71|XRN2_DROME 5'-3' exoribonuclease 2 homolog OS=Drosophila melanogaster GN=Rat1 PE=1 SV=2 509 683 8.0E-39
sp|Q9QSK5|EXON_IIV6 Putative exonuclease 012L OS=Invertebrate iridescent virus 6 GN=IIV6-012L PE=3 SV=1 1 362 2.0E-38
sp|Q60SG7|XRN2_CAEBR 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis briggsae GN=xrn-2 PE=3 SV=2 494 683 3.0E-34
sp|Q9U299|XRN2_CAEEL 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis elegans GN=xrn-2 PE=1 SV=2 509 683 1.0E-33
sp|Q197A1|EX0N_IIV3 Putative exonuclease 059L OS=Invertebrate iridescent virus 3 GN=IIV3-059L PE=3 SV=1 1 333 5.0E-31
sp|Q197A1|EX0N_IIV3 Putative exonuclease 059L OS=Invertebrate iridescent virus 3 GN=IIV3-059L PE=3 SV=1 500 680 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0004527 exonuclease activity Yes
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8404
MGVPKFFRWLSERYPAISQVIAENRIPEFDCLYLDMNGIIHNCTHKDAGEDATFRLSEEEMFLRIFNYIEHLFGK
IKPKQLFFMAIDGVAPRAKMNQQRARRFRTALDVEKARDKAIKDGIEMPKEEPFDSNCITPGTEFMAKLSQQLRY
FVNKKISEDTEWQGCEVVLSGHEVPGEGEHKIMEYIRNAKAQPQYNQNVRHCLYGLDADLIMLGLLSHDPHFCLL
REEVTFGRASKTKSKELEHQNFYLLHLCIVREYLEMEFQDLQSDGALNFSFDLERVIDDFILMAFFVGNDFLPNL
PGLHINEGALANMFGVYKRVLPTCEGYINENGVIHMARLRSLLEELSKLELISFENDVADEKWFASKQMEKHLAD
RNATKHRGRKNTHITMSSFQRDLWKQKIRPYVSNRSREALDLGAQLKAADRKFVQDLADAMHLQWSTKEDDNGER
RLVLAFPARGSGDDDNDDEEDDEDDDEEGNLAAWRVIKSYDKAQIVDVTTEDAQQHYEKLYQDKYQGWKTKYYLQ
KFPEWPAASFDREQTMLCENYVQGLQWVLFYYYKGIASWPWFYGYHYAPLISDVTKGLGADLNFKKGQPFKPYEQ
LMGVLPDRSKKIVPKVYHDLMTNPSSPIIDFYPRDFELDMNGKKMDWEAVVKIPFIDEKRLLAAMAGPNELLSDD
EKARNGFGVPIKFTYSPDVDYTYPSSMPGLFPDIPSCRCIENIFDLPDVEGLEYLSGLTNGALLNVEALAGFPTL
HNLPYTAQLVEGYGVNVFQSDSKNPSVVVTLTDTNMRTSIETWKAKLGQRCYVGYPFLQEAKVMKVRDELFTYEL
AENGKDVIAKDHSNREATEFAREAEYLESWYAKRLAVTIGQVECLVYVHMLKGLIKTEEGALIKEYAENPSLRNT
YASQTIVDEVINEDERFIEKAALPIEEEFPVGTRAFFLGEYAYGRPLEIIGHIYHKAEVVVSIPKTKEQPFAKQL
IHRAERANPYTPSFAVAKQLGMHPLVLSKITSSYQVMTSAGLKLNLGLNLKFEGRKLKVLGYSRKSHTGWEFSAL
AIKLITDYMLACPDFFAAIQREPQRSEVTETDLWPDQGVASQRIKDIVAWLKKQETGKFEKVPLEAEQLDSDAVM
ELAKAGEQVLQATQDADVKKLRGVPRTAILKPSDAELLLGNQKFSLGDRSSESAERQRRYC*
Coding >Hirsu2|8404
ATGGGTGTTCCCAAATTCTTCCGCTGGCTCTCTGAGCGCTATCCGGCCATATCACAAGTCATCGCCGAGAATAGG
ATACCAGAATTTGACTGCCTCTATCTCGACATGAATGGTATCATTCACAACTGTACCCACAAGGACGCCGGTGAA
GATGCGACTTTCCGACTAAGCGAGGAGGAAATGTTTTTACGAATCTTCAACTACATTGAACACTTGTTTGGCAAA
ATCAAGCCAAAGCAGCTGTTCTTCATGGCCATCGATGGTGTCGCGCCGCGCGCCAAGATGAACCAGCAGAGAGCT
CGCCGCTTTAGGACGGCTCTAGATGTCGAGAAGGCCCGTGACAAGGCCATCAAAGACGGCATCGAAATGCCCAAG
GAGGAACCCTTTGACAGCAATTGCATTACTCCGGGAACCGAGTTCATGGCGAAGCTGTCGCAACAGCTACGATAC
TTTGTCAACAAGAAGATTTCCGAAGACACCGAGTGGCAGGGCTGCGAAGTTGTCCTCTCAGGCCACGAAGTCCCC
GGCGAGGGGGAGCATAAGATCATGGAATATATCCGCAACGCAAAGGCCCAACCCCAGTACAACCAAAACGTCCGC
CACTGTCTTTACGGCCTGGACGCTGACTTGATCATGTTGGGCTTGTTGAGCCACGATCCTCATTTCTGTCTTCTC
CGGGAAGAAGTGACGTTCGGGCGGGCTTCGAAAACCAAGTCGAAGGAGCTTGAGCATCAGAATTTCTACCTTCTG
CATCTCTGCATCGTGAGGGAGTATCTGGAGATGGAGTTTCAGGACCTTCAAAGCGACGGCGCTCTGAACTTTTCG
TTCGATCTCGAGCGGGTCATTGATGATTTCATCTTGATGGCATTTTTTGTTGGAAATGACTTTCTACCGAACCTG
CCTGGGCTTCACATCAACGAAGGCGCTCTGGCTAACATGTTTGGGGTATACAAGAGGGTCCTTCCCACATGCGAA
GGATACATTAACGAAAACGGCGTCATCCACATGGCCCGTTTGCGCAGTCTCCTTGAGGAGCTGAGCAAGCTCGAA
TTGATTTCATTCGAGAATGACGTCGCAGACGAGAAGTGGTTTGCCTCTAAGCAGATGGAGAAGCACCTGGCGGAC
CGGAATGCAACGAAGCACAGGGGCCGCAAGAATACCCACATCACCATGAGCTCGTTTCAGCGAGATCTGTGGAAA
CAGAAAATCCGACCCTACGTCTCGAACCGATCAAGGGAGGCCTTGGATCTGGGCGCGCAACTCAAAGCAGCAGAC
CGGAAATTCGTTCAGGACCTGGCCGACGCCATGCACCTGCAGTGGTCAACGAAGGAGGATGATAACGGCGAACGA
CGCCTCGTCTTGGCATTTCCTGCTCGGGGAAGCGGAGATGACGACAACGACGATGAGGAAGACGATGAGGACGAC
GATGAAGAGGGAAACTTGGCTGCATGGCGTGTCATCAAGTCGTACGACAAGGCCCAGATCGTCGATGTGACTACC
GAAGACGCTCAACAGCACTACGAAAAGCTTTACCAAGACAAATATCAAGGCTGGAAGACGAAATACTACCTTCAA
AAGTTTCCCGAGTGGCCTGCCGCTAGCTTCGACCGAGAGCAAACGATGCTCTGCGAAAACTACGTCCAAGGCCTC
CAATGGGTCCTCTTCTACTACTATAAAGGCATAGCCTCTTGGCCATGGTTCTACGGCTATCATTACGCGCCCCTG
ATCTCAGATGTCACCAAGGGCCTCGGCGCGGACTTGAACTTCAAGAAAGGTCAGCCCTTCAAGCCGTACGAACAG
CTAATGGGAGTCTTGCCCGACCGCAGCAAAAAGATCGTTCCCAAGGTGTACCATGACCTCATGACGAACCCGAGT
TCCCCGATCATCGATTTTTATCCCCGGGACTTTGAGCTCGACATGAACGGCAAGAAGATGGACTGGGAGGCCGTG
GTCAAAATCCCGTTCATCGACGAGAAACGTCTTCTGGCGGCCATGGCTGGCCCGAACGAGCTTCTGAGTGACGAT
GAGAAGGCAAGAAATGGGTTCGGCGTGCCAATTAAGTTCACGTACTCTCCGGATGTCGACTACACCTATCCCTCC
TCGATGCCAGGCCTCTTTCCCGACATCCCATCTTGCCGGTGCATCGAAAACATCTTTGACTTGCCCGACGTGGAA
GGTCTTGAGTACTTGTCTGGCCTGACGAACGGCGCACTCTTAAACGTCGAGGCTTTGGCAGGGTTTCCCACACTC
CATAACCTACCGTACACTGCTCAGCTTGTCGAGGGCTACGGAGTCAATGTCTTCCAATCGGACAGCAAGAACCCT
AGCGTTGTCGTTACATTAACCGACACCAACATGCGAACAAGTATAGAAACCTGGAAGGCGAAACTCGGCCAGCGA
TGTTACGTTGGGTATCCTTTCCTGCAAGAAGCCAAGGTGATGAAGGTGCGGGACGAGCTTTTTACCTATGAACTG
GCAGAGAATGGCAAGGATGTCATCGCAAAGGACCATTCGAACAGAGAGGCTACCGAATTTGCCAGGGAAGCCGAG
TACCTGGAAAGCTGGTACGCGAAACGCCTGGCCGTCACCATCGGGCAAGTGGAGTGTCTCGTCTACGTCCACATG
CTCAAGGGTTTGATCAAAACGGAAGAAGGGGCATTGATCAAAGAATACGCGGAGAACCCGAGCCTTCGAAACACT
TACGCCTCTCAAACCATTGTTGATGAGGTCATCAACGAGGATGAGCGGTTCATCGAGAAAGCAGCGCTCCCCATC
GAGGAGGAATTCCCCGTCGGAACTCGAGCGTTCTTCCTCGGCGAGTACGCCTATGGGCGCCCGCTGGAAATTATC
GGCCACATCTACCACAAGGCAGAGGTCGTCGTGTCCATCCCGAAGACGAAGGAGCAGCCGTTTGCCAAGCAGCTT
ATTCATCGAGCAGAGCGCGCGAATCCATACACACCGTCTTTCGCTGTGGCCAAACAACTGGGGATGCACCCCCTG
GTATTGAGCAAGATCACCTCGTCCTATCAGGTCATGACTTCGGCGGGCCTCAAGCTGAATCTCGGTCTGAATCTC
AAGTTCGAGGGGCGCAAGCTCAAGGTCTTGGGATATTCGCGCAAGTCTCACACTGGCTGGGAATTCAGCGCTTTG
GCCATCAAATTGATCACGGATTACATGCTTGCCTGTCCCGACTTCTTCGCTGCGATCCAGAGGGAGCCCCAGAGG
AGTGAGGTCACGGAAACGGACCTCTGGCCCGACCAAGGCGTGGCATCCCAGCGCATCAAGGACATTGTGGCCTGG
TTGAAGAAACAGGAAACGGGCAAGTTTGAGAAGGTGCCGCTGGAAGCGGAGCAGCTCGACTCGGATGCTGTCATG
GAATTGGCCAAAGCCGGTGAGCAGGTCCTCCAGGCCACACAAGACGCCGACGTCAAAAAGCTCCGCGGCGTGCCT
CGTACGGCCATTTTGAAGCCATCAGACGCAGAGCTCCTGCTGGGCAACCAAAAATTCAGCTTGGGCGACCGATCG
TCGGAATCAGCCGAACGGCAACGGCGCTACTGCTAG
Transcript >Hirsu2|8404
ATGGGTGTTCCCAAATTCTTCCGCTGGCTCTCTGAGCGCTATCCGGCCATATCACAAGTCATCGCCGAGAATAGG
ATACCAGAATTTGACTGCCTCTATCTCGACATGAATGGTATCATTCACAACTGTACCCACAAGGACGCCGGTGAA
GATGCGACTTTCCGACTAAGCGAGGAGGAAATGTTTTTACGAATCTTCAACTACATTGAACACTTGTTTGGCAAA
ATCAAGCCAAAGCAGCTGTTCTTCATGGCCATCGATGGTGTCGCGCCGCGCGCCAAGATGAACCAGCAGAGAGCT
CGCCGCTTTAGGACGGCTCTAGATGTCGAGAAGGCCCGTGACAAGGCCATCAAAGACGGCATCGAAATGCCCAAG
GAGGAACCCTTTGACAGCAATTGCATTACTCCGGGAACCGAGTTCATGGCGAAGCTGTCGCAACAGCTACGATAC
TTTGTCAACAAGAAGATTTCCGAAGACACCGAGTGGCAGGGCTGCGAAGTTGTCCTCTCAGGCCACGAAGTCCCC
GGCGAGGGGGAGCATAAGATCATGGAATATATCCGCAACGCAAAGGCCCAACCCCAGTACAACCAAAACGTCCGC
CACTGTCTTTACGGCCTGGACGCTGACTTGATCATGTTGGGCTTGTTGAGCCACGATCCTCATTTCTGTCTTCTC
CGGGAAGAAGTGACGTTCGGGCGGGCTTCGAAAACCAAGTCGAAGGAGCTTGAGCATCAGAATTTCTACCTTCTG
CATCTCTGCATCGTGAGGGAGTATCTGGAGATGGAGTTTCAGGACCTTCAAAGCGACGGCGCTCTGAACTTTTCG
TTCGATCTCGAGCGGGTCATTGATGATTTCATCTTGATGGCATTTTTTGTTGGAAATGACTTTCTACCGAACCTG
CCTGGGCTTCACATCAACGAAGGCGCTCTGGCTAACATGTTTGGGGTATACAAGAGGGTCCTTCCCACATGCGAA
GGATACATTAACGAAAACGGCGTCATCCACATGGCCCGTTTGCGCAGTCTCCTTGAGGAGCTGAGCAAGCTCGAA
TTGATTTCATTCGAGAATGACGTCGCAGACGAGAAGTGGTTTGCCTCTAAGCAGATGGAGAAGCACCTGGCGGAC
CGGAATGCAACGAAGCACAGGGGCCGCAAGAATACCCACATCACCATGAGCTCGTTTCAGCGAGATCTGTGGAAA
CAGAAAATCCGACCCTACGTCTCGAACCGATCAAGGGAGGCCTTGGATCTGGGCGCGCAACTCAAAGCAGCAGAC
CGGAAATTCGTTCAGGACCTGGCCGACGCCATGCACCTGCAGTGGTCAACGAAGGAGGATGATAACGGCGAACGA
CGCCTCGTCTTGGCATTTCCTGCTCGGGGAAGCGGAGATGACGACAACGACGATGAGGAAGACGATGAGGACGAC
GATGAAGAGGGAAACTTGGCTGCATGGCGTGTCATCAAGTCGTACGACAAGGCCCAGATCGTCGATGTGACTACC
GAAGACGCTCAACAGCACTACGAAAAGCTTTACCAAGACAAATATCAAGGCTGGAAGACGAAATACTACCTTCAA
AAGTTTCCCGAGTGGCCTGCCGCTAGCTTCGACCGAGAGCAAACGATGCTCTGCGAAAACTACGTCCAAGGCCTC
CAATGGGTCCTCTTCTACTACTATAAAGGCATAGCCTCTTGGCCATGGTTCTACGGCTATCATTACGCGCCCCTG
ATCTCAGATGTCACCAAGGGCCTCGGCGCGGACTTGAACTTCAAGAAAGGTCAGCCCTTCAAGCCGTACGAACAG
CTAATGGGAGTCTTGCCCGACCGCAGCAAAAAGATCGTTCCCAAGGTGTACCATGACCTCATGACGAACCCGAGT
TCCCCGATCATCGATTTTTATCCCCGGGACTTTGAGCTCGACATGAACGGCAAGAAGATGGACTGGGAGGCCGTG
GTCAAAATCCCGTTCATCGACGAGAAACGTCTTCTGGCGGCCATGGCTGGCCCGAACGAGCTTCTGAGTGACGAT
GAGAAGGCAAGAAATGGGTTCGGCGTGCCAATTAAGTTCACGTACTCTCCGGATGTCGACTACACCTATCCCTCC
TCGATGCCAGGCCTCTTTCCCGACATCCCATCTTGCCGGTGCATCGAAAACATCTTTGACTTGCCCGACGTGGAA
GGTCTTGAGTACTTGTCTGGCCTGACGAACGGCGCACTCTTAAACGTCGAGGCTTTGGCAGGGTTTCCCACACTC
CATAACCTACCGTACACTGCTCAGCTTGTCGAGGGCTACGGAGTCAATGTCTTCCAATCGGACAGCAAGAACCCT
AGCGTTGTCGTTACATTAACCGACACCAACATGCGAACAAGTATAGAAACCTGGAAGGCGAAACTCGGCCAGCGA
TGTTACGTTGGGTATCCTTTCCTGCAAGAAGCCAAGGTGATGAAGGTGCGGGACGAGCTTTTTACCTATGAACTG
GCAGAGAATGGCAAGGATGTCATCGCAAAGGACCATTCGAACAGAGAGGCTACCGAATTTGCCAGGGAAGCCGAG
TACCTGGAAAGCTGGTACGCGAAACGCCTGGCCGTCACCATCGGGCAAGTGGAGTGTCTCGTCTACGTCCACATG
CTCAAGGGTTTGATCAAAACGGAAGAAGGGGCATTGATCAAAGAATACGCGGAGAACCCGAGCCTTCGAAACACT
TACGCCTCTCAAACCATTGTTGATGAGGTCATCAACGAGGATGAGCGGTTCATCGAGAAAGCAGCGCTCCCCATC
GAGGAGGAATTCCCCGTCGGAACTCGAGCGTTCTTCCTCGGCGAGTACGCCTATGGGCGCCCGCTGGAAATTATC
GGCCACATCTACCACAAGGCAGAGGTCGTCGTGTCCATCCCGAAGACGAAGGAGCAGCCGTTTGCCAAGCAGCTT
ATTCATCGAGCAGAGCGCGCGAATCCATACACACCGTCTTTCGCTGTGGCCAAACAACTGGGGATGCACCCCCTG
GTATTGAGCAAGATCACCTCGTCCTATCAGGTCATGACTTCGGCGGGCCTCAAGCTGAATCTCGGTCTGAATCTC
AAGTTCGAGGGGCGCAAGCTCAAGGTCTTGGGATATTCGCGCAAGTCTCACACTGGCTGGGAATTCAGCGCTTTG
GCCATCAAATTGATCACGGATTACATGCTTGCCTGTCCCGACTTCTTCGCTGCGATCCAGAGGGAGCCCCAGAGG
AGTGAGGTCACGGAAACGGACCTCTGGCCCGACCAAGGCGTGGCATCCCAGCGCATCAAGGACATTGTGGCCTGG
TTGAAGAAACAGGAAACGGGCAAGTTTGAGAAGGTGCCGCTGGAAGCGGAGCAGCTCGACTCGGATGCTGTCATG
GAATTGGCCAAAGCCGGTGAGCAGGTCCTCCAGGCCACACAAGACGCCGACGTCAAAAAGCTCCGCGGCGTGCCT
CGTACGGCCATTTTGAAGCCATCAGACGCAGAGCTCCTGCTGGGCAACCAAAAATTCAGCTTGGGCGACCGATCG
TCGGAATCAGCCGAACGGCAACGGCGCTACTGCTAG
Gene >Hirsu2|8404
ATGGGGCACGTCATCCCGTCACACCTGCCGCGATCAAGAAGTGTTCCGGGGCTTACCTACGTGACAGTGTTCCCA
AATTCTTCCGCTGGCTCTCTGAGCGCTATCCGGCCATATCACAAGTCATCGCCGAGAATAGGATACCAGAATTTG
ACTGCCTCTATGTATGAAGACCACCCGGCTCTACTGTCGCCCCATGCTAAGCCGATTCTTCCAGCTCGACATGAA
TGGTATCATTCACAACTGTACCCACAAGGACGCCGGTGAAGATGCGACTTTCCGACTAAGCGAGGAGGAAATGTT
TTTACGAATCTTCAACTACATTGAACACTTGTTTGGCAAAATCAAGCCAAAGCAGCTGTTCTTCATGGCCATCGA
TGGTGTCGCGCCGCGCGCCAAGATGAACCAGCAGAGAGCTCGCCGCTTTAGGACGGCTCTAGATGTCGAGAAGGC
CCGTGACAAGGCCATCAAAGACGGCATCGAAATGCCCAAGGAGGAACCCTTTGACAGCAATTGCATTACTCCGGG
TATGTCAAACACATCCAGGCTGGCATCAAACTACCCCCTTCGCAGAGATACTGACGGGGCTGAACAGGAACCGAG
TTCATGGCGAAGCTGTCGCAACAGCTACGATACTTTGTCAACAAGAAGATTTCCGAAGACACCGAGTGGCAGGGC
TGCGAAGTTGTCCTCTCAGGCCACGAAGTCCCCGGCGAGGGGGAGCATAAGATCATGGAATATATCCGCAACGCA
AAGGCCCAACCCCAGTACAACCAAAACGTCCGCCACTGTCTTTACGGCCTGGACGCTGACTTGATCATGTTGGGC
TTGTTGAGCCACGATCCTCATTTCTGTCTTCTCCGGGAAGAAGTGACGTTCGGGCGGGCTTCGAAAACCAAGTCG
AAGGAGCTTGAGCATCAGAATTTCTACCTTCTGCATCTCTGCATCGTGAGGGAGTATCTGGAGATGGAGTTTCAG
GACCTTCAAAGCGACGGCGCTCTGAACTTTTCGTTCGATCTCGAGCGGGTCATTGATGATTTCATCTTGATGGCA
TTTTTTGTTGGAAATGACTTTCTACCGAACCTGCCTGGGCTTCACATCAACGAAGGCGCTCTGGCTAACATGTTT
GGGGTATACAAGAGGGTCCTTCCCACATGCGAAGGATACATTAACGAAAACGGCGTCATCCACATGGCCCGTTTG
CGCAGTCTCCTTGAGGAGCTGAGCAAGCTCGAATTGATTTCATTCGAGAATGACGTCGCAGACGAGAAGTGGTTT
GCCTCTAAGCAGATGGAGAAGCACCTGGCGGACCGGAATGCAACGAAGCACAGGGGCCGCAAGAATACCCACATC
ACCATGAGCTCGTTTCAGCGAGATCTGTGGAAACAGAAAATCCGACCCTACGTCTCGAACCGATCAAGGGAGGCC
TTGGATCTGGGCGCGCAACTCAAAGCAGCAGACCGGAAATTCGTTCAGGACCTGGCCGACGCCATGCACCTGCAG
TGGTCAACGAAGGAGGATGATAACGGCGAACGACGCCTCGTCTTGGCATTTCCTGCTCGGGGAAGCGGAGATGAC
GACAACGACGATGAGGAAGACGATGAGGACGACGATGAAGAGGGAAACTTGGCTGCATGGCGTGTCATCAAGTCG
TACGACAAGGCCCAGATCGTCGATGTGACTACCGAAGACGCTCAACAGCACTACGAAAAGCTTTACCAAGACAAA
TATCAAGGCTGGAAGACGAAATACTACCTTCAAAAGTTTCCCGAGTGGCCTGCCGCTAGCTTCGACCGAGAGCAA
ACGATGCTCTGCGAAAACTACGTCCAAGGCCTCCAATGGGTCCTCTTCTACTACTATAAAGGCATAGCCTCTTGG
CCATGGTTCTACGGCTATCATTACGCGCCCCTGATCTCAGGTAAGTCCACAACGCTTCTGGCCGAATAAAACGAG
CTCAGGCTGATCAACGCCACCAGATGTCACCAAGGGCCTCGGCGCGGACTTGAACTTCAAGAAAGGTCAGCCCTT
CAAGCCGTACGAACAGCTAATGGGAGTCTTGCCCGACCGCAGCAAAAAGATCGTTCCCAAGGTGTACCATGACCT
CATGACGAACCCGAGTTCCCCGATCATCGATTTTTATCCCCGGGACTTTGAGCTCGACATGAACGGCAAGAAGAT
GGACTGGGAGGCCGTGGTCAAAATCCCGTTCATCGACGAGAAACGTCTTCTGGCGGCCATGGCTGGCCCGAACGA
GCTTCTGAGTGACGATGAGAAGGCAAGAAATGGGTTCGGCGTGCCAATTAAGTTCACGTACTCTCCGGATGTCGA
CTACACCTATCCCTCCTCGATGCCAGGCCTCTTTCCCGACATCCCATCTTGCCGGTGCATCGAAAACATCTTTGA
CTTGCCCGACGTGGAAGGTCTTGAGTACTTGTCTGGCCTGACGAACGGCGCACTCTTAAACGTCGAGGCTTTGGC
AGGGTTTCCCACACTCCATAACCTACCGTACACTGCTCAGCTTGTCGAGGGCTACGGAGTCAATGTCTTCCAATC
GGACAGCAAGAACCCTAGCGTTGTCGTTACATTAACCGACACCAACATGCGAACAAGTATAGAAACCTGGAAGGC
GAAACTCGGCCAGCGATGTTACGTTGGGTATCCTTTCCTGCAAGAAGCCAAGGTGATGAAGGTGCGGGACGAGCT
TTTTACCTATGAACTGGCAGAGAATGGCAAGGATGTCATCGCAAAGGACCATTCGAACAGAGAGGCTACCGAATT
TGCCAGGGAAGCCGAGTACCTGGAAAGCTGGTACGCGAAACGCCTGGCCGTCACCATCGGGCAAGTGGAGTGTCT
CGTCTACGTCCACATGCTCAAGGGTTTGATCAAAACGGAAGAAGGGGCATTGATCAAAGAATACGCGGAGAACCC
GAGCCTTCGAAACACTTACGCCTCTCAAACCATTGTTGATGAGGTCATCAACGAGGATGAGCGGTTCATCGAGAA
AGCAGCGCTCCCCATCGAGGAGGAATTCCCCGTCGGAACTCGAGCGTTCTTCCTCGGCGAGTACGCCTATGGGCG
CCCGCTGGAAATTATCGGCCACATCTACCACAAGGCAGAGGTCGTCGTGTCCATCCCGAAGACGAAGGAGCAGCC
GTTTGCCAAGCAGCTTATTCATCGAGCAGAGCGCGCGAATCCATACACACCGTCTTTCGCTGTGGCCAAACAACT
GGGGATGCACCCCCTGGTATTGAGCAAGATCACCTCGTCCTATCAGGTCATGACTTCGGCGGGCCTCAAGCTGAA
TCTCGGTCTGAATCTCAAGTTCGAGGGGCGCAAGCTCAAGGTCTTGGGATATTCGCGCAAGTCTCACACTGGCTG
GGAATTCAGCGCTTTGGCCATCAAATTGATCACGGATTACATGCTTGCCTGTCCCGACTTCTTCGCTGCGATCCA
GAGGGAGCCCCAGAGGAGTGAGGTCACGGAAACGGACCTCTGGCCCGACCAAGGCGTGGCATCCCAGCGCATCAA
GGACATTGTGGCCTGGTTGAAGAAACAGGAAACGGGCAAGTTTGAGAAGGTGCCGCTGGAAGCGGAGCAGCTCGA
CTCGGATGCTGTCATGGAATTGGCCAAAGCCGGTGAGCAGGTCCTCCAGGCCACACAAGACGCCGACGTCAAAAA
GCTCCGCGGCGTGCCTCGTACGGCCATTTTGAAGCCATCAGACGCAGAGCTCCTGCTGGGCAACCAAAAATTCAG
CTTGGGCGACCGAGTGACGTTTGCGTCCGCGGCAGGCAAGGTCCCCATTGCCACACGAGGAACAGTCGTCGGAAT
CAGCCGAACGGCAACGGCGCTACTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail