Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8403
Gene name
LocationContig_547:2319..3973
Strand-
Gene length (bp)1654
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex 3.8E-26 29 98
PF00400 WD40 WD domain, G-beta repeat 1.0E-01 183 220
PF00400 WD40 WD domain, G-beta repeat 4.2E-03 285 317
PF00400 WD40 WD domain, G-beta repeat 1.8E-06 323 361
PF00400 WD40 WD domain, G-beta repeat 3.4E-03 386 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7L0|HAT2_GIBZE Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 13 438 0.0E+00
sp|Q7S7N3|HAT2_NEUCR Histone acetyltransferase type B subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hat-2 PE=3 SV=2 6 437 0.0E+00
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 25 437 0.0E+00
sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 25 437 0.0E+00
sp|Q6P3H7|RBBP4_DANRE Histone-binding protein RBBP4 OS=Danio rerio GN=rbbp4 PE=2 SV=3 20 428 3.0E-151
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7L0|HAT2_GIBZE Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 13 438 0.0E+00
sp|Q7S7N3|HAT2_NEUCR Histone acetyltransferase type B subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hat-2 PE=3 SV=2 6 437 0.0E+00
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 25 437 0.0E+00
sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 25 437 0.0E+00
sp|Q6P3H7|RBBP4_DANRE Histone-binding protein RBBP4 OS=Danio rerio GN=rbbp4 PE=2 SV=3 20 428 3.0E-151
sp|Q60972|RBBP4_MOUSE Histone-binding protein RBBP4 OS=Mus musculus GN=Rbbp4 PE=1 SV=5 20 434 1.0E-150
sp|Q09028|RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapiens GN=RBBP4 PE=1 SV=3 20 434 1.0E-150
sp|Q3MHL3|RBBP4_BOVIN Histone-binding protein RBBP4 OS=Bos taurus GN=RBBP4 PE=1 SV=3 20 434 1.0E-150
sp|Q6INH0|RBP4B_XENLA Histone-binding protein RBBP4-B OS=Xenopus laevis GN=rbbp4-b PE=1 SV=3 20 434 2.0E-150
sp|Q9W7I5|RBBP4_CHICK Histone-binding protein RBBP4 OS=Gallus gallus GN=RBBP4 PE=1 SV=3 20 434 2.0E-150
sp|Q5M7K4|RBBP4_XENTR Histone-binding protein RBBP4 OS=Xenopus tropicalis GN=rbbp4 PE=2 SV=3 20 434 2.0E-150
sp|Q5RF92|RBBP4_PONAB Histone-binding protein RBBP4 OS=Pongo abelii GN=RBBP4 PE=2 SV=3 20 434 8.0E-150
sp|O93377|RBP4A_XENLA Histone-binding protein RBBP4-A OS=Xenopus laevis GN=rbbp4-a PE=1 SV=3 20 434 4.0E-149
sp|Q8AVH1|RBBP7_XENLA Histone-binding protein RBBP7 OS=Xenopus laevis GN=rbbp7 PE=2 SV=1 19 437 7.0E-147
sp|Q7ZTY4|RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio GN=rbbp7 PE=2 SV=1 20 437 7.0E-147
sp|Q6P315|RBBP7_XENTR Histone-binding protein RBBP7 OS=Xenopus tropicalis GN=rbbp7 PE=2 SV=1 19 437 1.0E-146
sp|Q3SWX8|RBBP7_BOVIN Histone-binding protein RBBP7 OS=Bos taurus GN=RBBP7 PE=2 SV=1 19 437 4.0E-146
sp|Q24572|CAF1_DROME Probable histone-binding protein Caf1 OS=Drosophila melanogaster GN=Caf1 PE=1 SV=1 20 437 5.0E-146
sp|Q71UF4|RBBP7_RAT Histone-binding protein RBBP7 OS=Rattus norvegicus GN=Rbbp7 PE=2 SV=1 19 437 5.0E-146
sp|Q4R304|RBBP7_MACFA Histone-binding protein RBBP7 OS=Macaca fascicularis GN=RBBP7 PE=2 SV=1 19 437 5.0E-146
sp|Q16576|RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens GN=RBBP7 PE=1 SV=1 19 437 5.0E-146
sp|Q60973|RBBP7_MOUSE Histone-binding protein RBBP7 OS=Mus musculus GN=Rbbp7 PE=1 SV=1 19 437 6.0E-146
sp|Q9I8G9|RBBP7_CHICK Histone-binding protein RBBP7 OS=Gallus gallus GN=RBBP7 PE=1 SV=1 19 437 9.0E-146
sp|Q5R654|RBBP7_PONAB Histone-binding protein RBBP7 OS=Pongo abelii GN=RBBP7 PE=3 SV=1 19 437 5.0E-144
sp|Q4P553|HAT2_USTMA Histone acetyltransferase type B subunit 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT2 PE=3 SV=2 10 437 4.0E-141
sp|Q54SD4|RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum GN=rbbD PE=3 SV=1 20 431 2.0E-138
sp|O94244|HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis16 PE=1 SV=1 23 427 1.0E-136
sp|O22466|MSI1_SOLLC WD-40 repeat-containing protein MSI1 OS=Solanum lycopersicum GN=MSI1 PE=2 SV=1 24 435 1.0E-136
sp|Q10G81|MSI1_ORYSJ Histone-binding protein MSI1 homolog OS=Oryza sativa subsp. japonica GN=MSI1 PE=2 SV=1 25 435 9.0E-135
sp|O22467|MSI1_ARATH Histone-binding protein MSI1 OS=Arabidopsis thaliana GN=MSI1 PE=1 SV=1 25 435 8.0E-133
sp|P0CS36|HAT2_CRYNJ Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT2 PE=3 SV=1 11 418 1.0E-125
sp|P0CS37|HAT2_CRYNB Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT2 PE=3 SV=1 11 418 1.0E-125
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 14 438 1.0E-125
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 24 438 3.0E-123
sp|P90917|RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans GN=rba-1 PE=3 SV=1 28 427 1.0E-105
sp|O22469|MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana GN=MSI3 PE=1 SV=2 21 423 7.0E-101
sp|O22468|MSI2_ARATH WD-40 repeat-containing protein MSI2 OS=Arabidopsis thaliana GN=MSI2 PE=2 SV=1 27 423 6.0E-100
sp|Q6BK34|HAT2_DEBHA Histone acetyltransferase type B subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAT2 PE=3 SV=1 8 429 5.0E-98
sp|Q6CSI1|HAT2_KLULA Histone acetyltransferase type B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAT2 PE=3 SV=1 14 424 1.0E-94
sp|Q6C7Q4|HAT2_YARLI Histone acetyltransferase type B subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAT2 PE=3 SV=1 25 437 2.0E-93
sp|O14021|PRW1_SCHPO RbAp48-related WD40 repeat-containing protein prw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prw1 PE=1 SV=1 18 427 1.0E-92
sp|Q6FXI8|HAT2_CANGA Histone acetyltransferase type B subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAT2 PE=3 SV=1 27 423 1.0E-90
sp|Q75C99|HAT2_ASHGO Histone acetyltransferase type B subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAT2 PE=3 SV=1 3 424 5.0E-90
sp|Q8SRK1|HAT2_ENCCU Histone acetyltransferase type B subunit 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HAT2 PE=1 SV=1 20 421 1.0E-87
sp|P39984|HAT2_YEAST Histone acetyltransferase type B subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAT2 PE=1 SV=1 27 423 4.0E-86
sp|Q59RH5|HAT2_CANAL Histone acetyltransferase type B subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAT2 PE=3 SV=1 27 437 1.0E-77
sp|Q9Y825|YEC6_SCHPO Uncharacterized WD repeat-containing protein C25H1.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25H1.06 PE=3 SV=1 13 418 7.0E-65
sp|O22607|MSI4_ARATH WD-40 repeat-containing protein MSI4 OS=Arabidopsis thaliana GN=MSI4 PE=1 SV=3 14 423 4.0E-49
sp|P13712|MSI1_YEAST Chromatin assembly factor 1 subunit p50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSI1 PE=1 SV=1 27 425 3.0E-48
sp|Q9SU78|MSI5_ARATH WD-40 repeat-containing protein MSI5 OS=Arabidopsis thaliana GN=MSI5 PE=1 SV=2 27 428 5.0E-45
sp|Q54ED4|GRWD1_DICDI Glutamate-rich WD repeat-containing protein 1 OS=Dictyostelium discoideum GN=grwd1 PE=3 SV=1 135 422 1.0E-28
sp|Q9BQ67|GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens GN=GRWD1 PE=1 SV=1 180 409 2.0E-26
sp|Q5XI13|GRWD1_RAT Glutamate-rich WD repeat-containing protein 1 OS=Rattus norvegicus GN=Grwd1 PE=2 SV=1 180 409 9.0E-26
sp|Q810D6|GRWD1_MOUSE Glutamate-rich WD repeat-containing protein 1 OS=Mus musculus GN=Grwd1 PE=1 SV=2 180 409 2.0E-25
sp|Q9P783|RRB1_SCHPO Ribosome assembly protein rrb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrb1 PE=1 SV=1 39 409 2.0E-25
sp|Q1JQD2|GRWD1_BOVIN Glutamate-rich WD repeat-containing protein 1 OS=Bos taurus GN=GRWD1 PE=2 SV=1 180 409 3.0E-25
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 187 420 2.0E-19
sp|Q04225|RRB1_YEAST Ribosome assembly protein RRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRB1 PE=1 SV=1 39 419 1.0E-17
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 150 399 2.0E-17
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 100 420 2.0E-16
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 152 419 2.0E-16
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 120 417 2.0E-16
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 146 421 5.0E-16
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 207 421 3.0E-15
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 174 417 5.0E-15
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 180 399 9.0E-15
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 203 422 2.0E-14
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 123 417 2.0E-14
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 180 399 2.0E-14
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 146 417 2.0E-14
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 180 399 2.0E-14
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 130 427 2.0E-14
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 207 420 3.0E-14
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 123 417 3.0E-14
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 123 417 3.0E-14
sp|Q9XF57|PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana GN=PEX7 PE=1 SV=2 160 361 3.0E-14
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 187 420 4.0E-14
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 150 427 4.0E-14
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 136 428 8.0E-14
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 206 428 9.0E-14
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 162 418 1.0E-13
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 207 412 1.0E-13
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 135 417 2.0E-13
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 146 364 2.0E-13
sp|O80990|CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 126 420 2.0E-13
sp|Q2TZG4|PFS2_ASPOR Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 197 421 2.0E-13
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 207 417 3.0E-13
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 180 401 4.0E-13
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 150 364 4.0E-13
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 178 418 5.0E-13
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 189 421 6.0E-13
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 123 417 6.0E-13
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 187 417 8.0E-13
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 179 418 9.0E-13
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 187 423 1.0E-12
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 207 422 1.0E-12
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 187 425 1.0E-12
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 179 357 1.0E-12
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 113 421 1.0E-12
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 186 421 1.0E-12
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 206 428 2.0E-12
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 180 401 2.0E-12
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 186 421 4.0E-12
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 118 418 4.0E-12
sp|Q5BIM8|ERCC8_BOVIN DNA excision repair protein ERCC-8 OS=Bos taurus GN=ERCC8 PE=2 SV=1 132 332 4.0E-12
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 137 362 4.0E-12
sp|Q13216|ERCC8_HUMAN DNA excision repair protein ERCC-8 OS=Homo sapiens GN=ERCC8 PE=1 SV=1 132 332 4.0E-12
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 189 422 5.0E-12
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 186 420 5.0E-12
sp|Q4X1Y0|PFS2_ASPFU Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1 197 421 5.0E-12
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 141 362 5.0E-12
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 187 361 6.0E-12
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 207 417 7.0E-12
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 188 417 7.0E-12
sp|P83774|GBLP_CANAL Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 187 417 7.0E-12
sp|Q8CFD5|ERCC8_MOUSE DNA excision repair protein ERCC-8 OS=Mus musculus GN=Ercc8 PE=2 SV=2 132 332 7.0E-12
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 207 419 8.0E-12
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 190 437 8.0E-12
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 177 422 9.0E-12
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 154 366 9.0E-12
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 190 364 9.0E-12
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 187 422 9.0E-12
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 190 437 9.0E-12
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 154 366 9.0E-12
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 136 367 1.0E-11
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 235 417 1.0E-11
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 280 426 1.0E-11
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 190 364 1.0E-11
sp|Q9Y6I7|WSB1_HUMAN WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 207 421 1.0E-11
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 207 419 1.0E-11
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 179 419 1.0E-11
sp|Q5AZX0|PFS2_EMENI Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 197 421 1.0E-11
sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 141 368 1.0E-11
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 179 419 1.0E-11
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 150 434 1.0E-11
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 179 419 1.0E-11
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 137 421 1.0E-11
sp|Q8K4P0|WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 141 368 1.0E-11
sp|Q8L611|SC31B_ARATH Protein transport protein SEC31 homolog B OS=Arabidopsis thaliana GN=SEC31B PE=1 SV=1 153 419 1.0E-11
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 187 418 2.0E-11
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 153 417 2.0E-11
sp|Q873A1|SEC31_NEUCR Protein transport protein sec31 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec31 PE=3 SV=1 202 432 2.0E-11
sp|Q8K0G5|TSSC1_MOUSE Protein TSSC1 OS=Mus musculus GN=Tssc1 PE=1 SV=2 175 423 2.0E-11
sp|Q75AV4|PFS2_ASHGO Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 187 373 2.0E-11
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 207 417 2.0E-11
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 179 418 2.0E-11
sp|Q8SRK1|HAT2_ENCCU Histone acetyltransferase type B subunit 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HAT2 PE=1 SV=1 130 275 3.0E-11
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 186 430 3.0E-11
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 206 428 3.0E-11
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 150 427 3.0E-11
sp|Q5PPK9|TSSC1_RAT Protein TSSC1 OS=Rattus norvegicus GN=Tssc1 PE=2 SV=1 175 423 3.0E-11
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 207 419 3.0E-11
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 187 365 4.0E-11
sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 207 417 4.0E-11
sp|Q8K4P0|WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 207 417 4.0E-11
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 135 420 4.0E-11
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 93 421 4.0E-11
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 196 422 4.0E-11
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 186 421 4.0E-11
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 137 364 5.0E-11
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 154 363 5.0E-11
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 137 419 5.0E-11
sp|Q4P2B6|SEC31_USTMA Protein transport protein SEC31 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEC31 PE=3 SV=1 111 416 5.0E-11
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 150 424 5.0E-11
sp|Q3KPT3|TSSC1_XENLA Protein TSSC1 OS=Xenopus laevis GN=tssc1 PE=2 SV=1 135 423 5.0E-11
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 207 421 5.0E-11
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 179 419 5.0E-11
sp|Q55E54|COROB_DICDI Coronin-B OS=Dictyostelium discoideum GN=corB PE=1 SV=1 240 396 5.0E-11
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 127 417 5.0E-11
sp|Q9W5Z5|WSB1_TAKRU WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 207 421 5.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 207 419 6.0E-11
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 206 433 6.0E-11
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 238 363 7.0E-11
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 179 418 7.0E-11
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 228 417 8.0E-11
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 118 418 8.0E-11
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 150 424 8.0E-11
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 187 373 8.0E-11
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 195 367 8.0E-11
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 187 367 8.0E-11
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 197 420 9.0E-11
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 189 367 9.0E-11
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 280 417 1.0E-10
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 187 417 1.0E-10
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 232 363 1.0E-10
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 232 363 1.0E-10
sp|Q2GVT8|SEC31_CHAGB Protein transport protein SEC31 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC31 PE=3 SV=1 202 417 1.0E-10
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 232 363 1.0E-10
sp|Q12523|YP247_YEAST WD repeat-containing protein YPL247C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL247C PE=1 SV=1 159 362 1.0E-10
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 232 363 1.0E-10
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 207 362 1.0E-10
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 126 429 1.0E-10
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 179 418 1.0E-10
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 195 436 1.0E-10
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 186 364 1.0E-10
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 207 362 1.0E-10
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 207 362 1.0E-10
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 207 362 1.0E-10
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 190 364 1.0E-10
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 179 419 1.0E-10
sp|Q5M8I4|TSSC1_XENTR Protein TSSC1 OS=Xenopus tropicalis GN=tssc1 PE=2 SV=1 135 423 1.0E-10
sp|A4RD35|SEC31_MAGO7 Protein transport protein SEC31 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC31 PE=3 SV=1 185 432 1.0E-10
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 190 417 1.0E-10
sp|Q99LL5|PWP1_MOUSE Periodic tryptophan protein 1 homolog OS=Mus musculus GN=Pwp1 PE=1 SV=1 286 362 1.0E-10
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 179 418 1.0E-10
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 189 367 2.0E-10
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 161 421 2.0E-10
sp|Q873A1|SEC31_NEUCR Protein transport protein sec31 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec31 PE=3 SV=1 196 416 2.0E-10
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 232 363 2.0E-10
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 181 421 2.0E-10
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 126 429 2.0E-10
sp|A8XL02|WDR12_CAEBR Ribosome biogenesis protein WDR12 homolog OS=Caenorhabditis briggsae GN=wdr-12 PE=3 SV=2 183 363 2.0E-10
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 232 363 2.0E-10
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 196 364 2.0E-10
sp|A8QB65|WDR12_BRUMA Ribosome biogenesis protein WDR12 homolog OS=Brugia malayi GN=Bm1_47965 PE=3 SV=1 183 354 2.0E-10
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 175 417 2.0E-10
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 137 436 2.0E-10
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 196 364 2.0E-10
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 190 361 2.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 207 426 3.0E-10
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 137 436 3.0E-10
sp|P43254|COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana GN=COP1 PE=1 SV=2 149 417 3.0E-10
sp|Q7ZVL2|WDR24_DANRE WD repeat-containing protein 24 OS=Danio rerio GN=wdr24 PE=2 SV=1 199 367 3.0E-10
sp|Q0VC24|WDR12_BOVIN Ribosome biogenesis protein WDR12 OS=Bos taurus GN=WDR12 PE=2 SV=1 182 357 3.0E-10
sp|Q6DJD8|COR2B_XENLA Coronin-2B OS=Xenopus laevis GN=coro2b PE=2 SV=1 241 416 3.0E-10
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 232 363 3.0E-10
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 232 363 3.0E-10
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 232 363 3.0E-10
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 176 361 3.0E-10
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 189 361 3.0E-10
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 137 421 4.0E-10
sp|P20053|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 153 370 4.0E-10
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 150 427 4.0E-10
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 175 361 4.0E-10
sp|Q9USR0|CKN1_SCHPO DNA excision repair protein ckn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ckn1 PE=1 SV=1 207 419 4.0E-10
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 206 428 4.0E-10
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 232 363 4.0E-10
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 232 363 4.0E-10
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 150 434 4.0E-10
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 137 436 4.0E-10
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 137 421 4.0E-10
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 179 418 4.0E-10
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 187 373 4.0E-10
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 207 360 5.0E-10
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 137 421 5.0E-10
sp|Q99LL5|PWP1_MOUSE Periodic tryptophan protein 1 homolog OS=Mus musculus GN=Pwp1 PE=1 SV=1 189 420 5.0E-10
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 195 367 5.0E-10
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 195 367 5.0E-10
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 187 419 5.0E-10
sp|A8WGE3|COR2B_XENTR Coronin-2B OS=Xenopus tropicalis GN=coro2b PE=2 SV=1 241 367 5.0E-10
sp|Q9USR0|CKN1_SCHPO DNA excision repair protein ckn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ckn1 PE=1 SV=1 176 362 6.0E-10
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 232 363 6.0E-10
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 154 422 6.0E-10
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 209 427 6.0E-10
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 207 367 6.0E-10
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 195 421 7.0E-10
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 187 361 7.0E-10
sp|Q3TZ89|SC31B_MOUSE Protein transport protein Sec31B OS=Mus musculus GN=Sec31b PE=1 SV=2 190 427 7.0E-10
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 207 429 7.0E-10
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 239 421 7.0E-10
sp|P27133|COROA_DICDI Coronin-A OS=Dictyostelium discoideum GN=corA PE=1 SV=2 237 359 7.0E-10
sp|F4ICD9|SC31A_ARATH Protein transport protein SEC31 homolog A OS=Arabidopsis thaliana GN=SEC31A PE=1 SV=1 132 419 8.0E-10
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 207 363 8.0E-10
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 228 417 9.0E-10
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 92 418 9.0E-10
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 92 418 9.0E-10
sp|O13923|CORO_SCHPO Coronin-like protein crn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crn1 PE=1 SV=1 179 367 9.0E-10
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 183 360 9.0E-10
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 207 360 9.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 186 421 1.0E-09
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 280 417 1.0E-09
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 207 421 1.0E-09
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 240 422 1.0E-09
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 240 422 1.0E-09
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 232 363 1.0E-09
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 131 419 1.0E-09
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 207 360 1.0E-09
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 207 417 1.0E-09
sp|Q4WTL0|CIAO1_ASPFU Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cia1 PE=3 SV=1 153 360 1.0E-09
sp|B0XQ15|CIAO1_ASPFC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cia1 PE=3 SV=1 153 360 1.0E-09
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 118 418 1.0E-09
sp|Q2HJ56|PWP1_BOVIN Periodic tryptophan protein 1 homolog OS=Bos taurus GN=PWP1 PE=2 SV=1 189 420 1.0E-09
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 207 362 1.0E-09
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 187 370 1.0E-09
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 187 370 1.0E-09
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 207 360 2.0E-09
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 207 360 2.0E-09
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 207 428 2.0E-09
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 137 438 2.0E-09
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 137 438 2.0E-09
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 137 438 2.0E-09
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 137 438 2.0E-09
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 137 438 2.0E-09
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 137 438 2.0E-09
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 137 438 2.0E-09
sp|A5DB75|SEC31_PICGU Protein transport protein SEC31 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC31 PE=3 SV=2 195 432 2.0E-09
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 207 417 2.0E-09
sp|Q5REE6|WDR12_PONAB Ribosome biogenesis protein WDR12 OS=Pongo abelii GN=WDR12 PE=2 SV=1 182 357 2.0E-09
sp|Q55CT5|SEC31_DICDI Protein transport protein SEC31 OS=Dictyostelium discoideum GN=sec31 PE=3 SV=1 153 364 2.0E-09
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 183 360 2.0E-09
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 183 360 2.0E-09
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 189 434 2.0E-09
sp|Q9GZL7|WDR12_HUMAN Ribosome biogenesis protein WDR12 OS=Homo sapiens GN=WDR12 PE=1 SV=2 182 357 2.0E-09
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 190 364 2.0E-09
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 183 428 2.0E-09
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 197 427 2.0E-09
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 232 420 2.0E-09
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 280 417 3.0E-09
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 129 417 3.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 207 420 3.0E-09
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 137 421 3.0E-09
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 184 419 3.0E-09
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 190 361 3.0E-09
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 142 419 3.0E-09
sp|Q13610|PWP1_HUMAN Periodic tryptophan protein 1 homolog OS=Homo sapiens GN=PWP1 PE=1 SV=1 189 420 3.0E-09
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 190 361 3.0E-09
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 183 360 3.0E-09
sp|Q6BU94|PRP46_DEBHA Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 137 433 3.0E-09
sp|Q6QEF8|CORO6_HUMAN Coronin-6 OS=Homo sapiens GN=CORO6 PE=1 SV=2 286 416 3.0E-09
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 185 421 3.0E-09
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 207 360 3.0E-09
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 175 361 3.0E-09
sp|O94620|CWF17_SCHPO Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 132 417 3.0E-09
sp|O59894|PEX7_PICPA Peroxisomal targeting signal 2 receptor OS=Komagataella pastoris GN=PEX7 PE=3 SV=1 150 417 3.0E-09
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 286 419 4.0E-09
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 207 360 4.0E-09
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 196 364 4.0E-09
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 207 360 4.0E-09
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 137 418 4.0E-09
sp|Q28DW0|CIAO1_XENTR Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 129 418 4.0E-09
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 196 364 4.0E-09
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 196 364 4.0E-09
sp|Q9JJA4|WDR12_MOUSE Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1 182 363 4.0E-09
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 179 419 4.0E-09
sp|Q5AZM3|SEC31_EMENI Protein transport protein sec31 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec31 PE=3 SV=2 194 433 4.0E-09
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 207 360 4.0E-09
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 118 418 4.0E-09
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 189 393 5.0E-09
sp|Q8CFJ9|WDR24_MOUSE WD repeat-containing protein 24 OS=Mus musculus GN=Wdr24 PE=1 SV=1 199 363 5.0E-09
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 207 360 5.0E-09
sp|Q920M5|CORO6_MOUSE Coronin-6 OS=Mus musculus GN=Coro6 PE=1 SV=1 286 416 5.0E-09
sp|O54927|WSB1_MOUSE WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 207 421 5.0E-09
sp|Q6FJS0|PFS2_CANGA Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 187 373 5.0E-09
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 207 360 5.0E-09
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 137 421 6.0E-09
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 234 422 6.0E-09
sp|Q9P775|YBEG_SCHPO Uncharacterized WD repeat-containing protein C17D11.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.16 PE=1 SV=1 190 420 6.0E-09
sp|Q920J3|CORO6_RAT Coronin-6 OS=Rattus norvegicus GN=Coro6 PE=2 SV=2 286 416 6.0E-09
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 186 421 7.0E-09
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 132 362 7.0E-09
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 233 363 7.0E-09
sp|Q9UQ03|COR2B_HUMAN Coronin-2B OS=Homo sapiens GN=CORO2B PE=1 SV=4 241 416 7.0E-09
sp|P49178|GBB_MAIZE Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 137 363 7.0E-09
sp|A2AKB9|DCA10_MOUSE DDB1- and CUL4-associated factor 10 OS=Mus musculus GN=Dcaf10 PE=1 SV=1 261 414 7.0E-09
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 166 420 8.0E-09
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 240 422 8.0E-09
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 137 421 8.0E-09
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 233 363 8.0E-09
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 207 368 8.0E-09
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 232 420 8.0E-09
sp|Q5FW06|DCA10_XENTR DDB1- and CUL4-associated factor 10 OS=Xenopus tropicalis GN=dcaf10 PE=2 SV=2 261 414 8.0E-09
sp|Q9UT57|CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 178 417 8.0E-09
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 232 420 8.0E-09
sp|Q8BX17|GEMI5_MOUSE Gem-associated protein 5 OS=Mus musculus GN=Gemin5 PE=1 SV=2 145 364 8.0E-09
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 207 428 9.0E-09
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 187 421 9.0E-09
sp|Q5AZM3|SEC31_EMENI Protein transport protein sec31 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec31 PE=3 SV=2 196 419 9.0E-09
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 207 363 9.0E-09
sp|Q8BH44|COR2B_MOUSE Coronin-2B OS=Mus musculus GN=Coro2b PE=1 SV=2 241 416 9.0E-09
sp|Q5QP82|DCA10_HUMAN DDB1- and CUL4-associated factor 10 OS=Homo sapiens GN=DCAF10 PE=1 SV=1 261 414 9.0E-09
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 188 421 9.0E-09
sp|A2QPW4|CIAO1_ASPNC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cia1 PE=3 SV=1 147 418 9.0E-09
sp|Q5BJ90|WDR12_XENTR Ribosome biogenesis protein wdr12 OS=Xenopus tropicalis GN=wdr12 PE=2 SV=1 183 357 9.0E-09
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 154 418 1.0E-08
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 166 421 1.0E-08
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 137 421 1.0E-08
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 137 421 1.0E-08
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 118 423 1.0E-08
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 137 418 1.0E-08
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 232 420 1.0E-08
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 232 363 1.0E-08
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 132 362 1.0E-08
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 207 363 1.0E-08
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 118 423 1.0E-08
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 182 419 1.0E-08
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 232 363 1.0E-08
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 137 429 1.0E-08
sp|Q5XJP1|TSSC1_DANRE Protein TSSC1 OS=Danio rerio GN=tssc1 PE=2 SV=1 182 423 1.0E-08
sp|Q29KQ0|WDR12_DROPS Ribosome biogenesis protein WDR12 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA19813 PE=3 SV=1 207 424 1.0E-08
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 187 360 1.0E-08
sp|B6H7A3|CIAO1_PENRW Probable cytosolic iron-sulfur protein assembly protein 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=cia1 PE=3 SV=1 153 360 1.0E-08
sp|Q7ZX22|WDR24_XENLA WD repeat-containing protein 24 OS=Xenopus laevis GN=wdr24 PE=2 SV=1 199 363 1.0E-08
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 118 418 1.0E-08
sp|O80990|CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 231 417 2.0E-08
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 137 419 2.0E-08
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 253 421 2.0E-08
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 256 362 2.0E-08
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 256 362 2.0E-08
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 207 363 2.0E-08
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 178 360 2.0E-08
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 178 360 2.0E-08
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 207 363 2.0E-08
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 207 428 2.0E-08
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 207 428 2.0E-08
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 207 428 2.0E-08
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 277 418 2.0E-08
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 277 418 2.0E-08
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 232 420 2.0E-08
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 207 365 2.0E-08
sp|Q9SYX2|SPA1_ARATH Protein SUPPRESSOR OF PHYA-105 1 OS=Arabidopsis thaliana GN=SPA1 PE=1 SV=1 154 391 2.0E-08
sp|Q06440|CORO_YEAST Coronin-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRN1 PE=1 SV=1 179 361 2.0E-08
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 202 426 2.0E-08
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 201 399 2.0E-08
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 187 428 2.0E-08
sp|A1C6X5|SEC31_ASPCL Protein transport protein sec31 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec31 PE=3 SV=1 205 433 2.0E-08
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 232 420 2.0E-08
sp|B4GT01|WDR12_DROPE Ribosome biogenesis protein WDR12 homolog OS=Drosophila persimilis GN=GL26386 PE=3 SV=1 207 424 2.0E-08
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 232 420 2.0E-08
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 232 420 2.0E-08
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 232 420 2.0E-08
sp|P91343|WDR12_CAEEL Ribosome biogenesis protein WDR12 homolog OS=Caenorhabditis elegans GN=wdr-12 PE=3 SV=1 183 357 2.0E-08
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 232 420 2.0E-08
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 184 375 2.0E-08
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 232 420 2.0E-08
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 187 418 2.0E-08
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 232 420 2.0E-08
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 231 419 2.0E-08
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 187 361 2.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 201 360 2.0E-08
sp|B4LS78|WDR12_DROVI Ribosome biogenesis protein WDR12 homolog OS=Drosophila virilis GN=GJ17641 PE=3 SV=1 207 424 2.0E-08
sp|O74340|DCA13_SCHPO Protein sof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sof1 PE=3 SV=1 145 319 2.0E-08
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 196 400 2.0E-08
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 232 361 2.0E-08
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 195 363 2.0E-08
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 153 418 3.0E-08
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 166 420 3.0E-08
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 207 360 3.0E-08
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 256 362 3.0E-08
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 256 362 3.0E-08
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 256 362 3.0E-08
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 256 362 3.0E-08
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 256 362 3.0E-08
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 256 362 3.0E-08
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 256 362 3.0E-08
sp|Q9USR0|CKN1_SCHPO DNA excision repair protein ckn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ckn1 PE=1 SV=1 286 427 3.0E-08
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 256 362 3.0E-08
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 256 362 3.0E-08
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 256 362 3.0E-08
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 187 367 3.0E-08
sp|A1CQL6|CIAO1_ASPCL Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cia1 PE=3 SV=1 153 360 3.0E-08
sp|A8PWQ8|CIAO1_MALGO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CIA1 PE=3 SV=1 137 417 3.0E-08
sp|Q12417|PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 93 362 3.0E-08
sp|P36408|GBB_DICDI Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 186 360 3.0E-08
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 185 410 3.0E-08
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 187 363 3.0E-08
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 233 422 3.0E-08
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 131 421 3.0E-08
sp|Q9VAT2|DCA10_DROME DDB1- and CUL4-associated factor 10 homolog OS=Drosophila melanogaster GN=CG1523 PE=1 SV=1 286 370 3.0E-08
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 207 423 3.0E-08
sp|Q6NWH1|DCA10_DANRE DDB1- and CUL4-associated factor 10 OS=Danio rerio GN=dcaf10 PE=2 SV=2 259 414 3.0E-08
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 207 423 3.0E-08
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 132 362 3.0E-08
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 137 419 3.0E-08
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 232 363 3.0E-08
sp|P61480|WDR12_RAT Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1 182 357 3.0E-08
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 187 363 3.0E-08
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 187 363 3.0E-08
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 187 361 3.0E-08
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 240 433 3.0E-08
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 187 417 4.0E-08
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 187 367 4.0E-08
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 211 419 4.0E-08
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 137 421 4.0E-08
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 240 427 4.0E-08
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 178 360 4.0E-08
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 207 426 4.0E-08
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 232 363 4.0E-08
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 137 418 4.0E-08
sp|A5DTX3|SEC31_LODEL Protein transport protein SEC31 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC31 PE=3 SV=1 178 432 4.0E-08
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 187 422 4.0E-08
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 197 362 4.0E-08
sp|Q7SYD5|SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio GN=sec31a PE=2 SV=1 190 419 4.0E-08
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 135 367 4.0E-08
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 232 420 4.0E-08
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 183 363 4.0E-08
sp|Q8AVS9|DCA10_XENLA DDB1- and CUL4-associated factor 10 OS=Xenopus laevis GN=dcaf10 PE=2 SV=1 276 414 4.0E-08
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 206 424 4.0E-08
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 146 360 4.0E-08
sp|Q873A1|SEC31_NEUCR Protein transport protein sec31 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec31 PE=3 SV=1 107 404 5.0E-08
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 178 360 5.0E-08
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 178 360 5.0E-08
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 178 360 5.0E-08
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 178 360 5.0E-08
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 178 360 5.0E-08
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 178 360 5.0E-08
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 178 360 5.0E-08
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 240 427 5.0E-08
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 187 420 5.0E-08
sp|Q5AAU3|SEC31_CANAL Protein transport protein SEC31 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC31 PE=3 SV=1 195 423 5.0E-08
sp|B4JPT9|WDR12_DROGR Ribosome biogenesis protein WDR12 homolog OS=Drosophila grimshawi GN=GH13339 PE=3 SV=1 203 424 5.0E-08
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 182 419 5.0E-08
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 207 421 5.0E-08
sp|Q32LP9|COR2A_BOVIN Coronin-2A OS=Bos taurus GN=CORO2A PE=2 SV=1 150 319 5.0E-08
sp|B3MJV8|WDR12_DROAN Ribosome biogenesis protein WDR12 homolog OS=Drosophila ananassae GN=GF14067 PE=3 SV=1 207 424 5.0E-08
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 100 361 6.0E-08
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 240 427 6.0E-08
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 196 422 6.0E-08
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 178 417 6.0E-08
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 232 420 6.0E-08
sp|Q8C0P5|COR2A_MOUSE Coronin-2A OS=Mus musculus GN=Coro2a PE=2 SV=1 241 416 6.0E-08
sp|Q5ZMV9|WDR24_CHICK WD repeat-containing protein 24 OS=Gallus gallus GN=WDR24 PE=2 SV=1 207 370 6.0E-08
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 137 429 6.0E-08
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 137 429 6.0E-08
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 137 429 6.0E-08
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 202 433 6.0E-08
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 137 429 6.0E-08
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 207 363 6.0E-08
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 187 360 7.0E-08
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 166 360 7.0E-08
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 283 419 7.0E-08
sp|A1C6X5|SEC31_ASPCL Protein transport protein sec31 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec31 PE=3 SV=1 186 419 7.0E-08
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 187 419 7.0E-08
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 196 367 7.0E-08
sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 171 417 7.0E-08
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 183 419 7.0E-08
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 183 419 7.0E-08
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 201 399 7.0E-08
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 293 420 8.0E-08
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 232 363 8.0E-08
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 283 419 8.0E-08
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 178 360 8.0E-08
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 187 367 8.0E-08
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 232 363 8.0E-08
sp|A1D3I2|CIAO1_NEOFI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cia1 PE=3 SV=1 153 360 8.0E-08
sp|Q0CYG9|SEC31_ASPTN Protein transport protein sec31 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec31 PE=3 SV=1 109 419 8.0E-08
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 207 429 8.0E-08
sp|Q5BJQ6|CSTF1_RAT Cleavage stimulation factor subunit 1 OS=Rattus norvegicus GN=Cstf1 PE=2 SV=1 137 363 8.0E-08
sp|Q99LC2|CSTF1_MOUSE Cleavage stimulation factor subunit 1 OS=Mus musculus GN=Cstf1 PE=1 SV=1 137 363 8.0E-08
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 286 426 9.0E-08
sp|Q8L611|SC31B_ARATH Protein transport protein SEC31 homolog B OS=Arabidopsis thaliana GN=SEC31B PE=1 SV=1 137 369 9.0E-08
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 207 367 9.0E-08
sp|P39108|PEX7_YEAST Peroxisomal targeting signal 2 receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX7 PE=1 SV=1 160 417 9.0E-08
sp|Q4X0M4|SEC31_ASPFU Protein transport protein sec31 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec31 PE=3 SV=1 186 419 9.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 268 422 1.0E-07
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 284 419 1.0E-07
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 278 418 1.0E-07
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 207 417 1.0E-07
sp|Q6QEF8|CORO6_HUMAN Coronin-6 OS=Homo sapiens GN=CORO6 PE=1 SV=2 179 361 1.0E-07
sp|P49178|GBB_MAIZE Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 137 368 1.0E-07
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 196 364 1.0E-07
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 207 431 1.0E-07
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 207 428 1.0E-07
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 233 363 1.0E-07
sp|A1CGS0|SEC13_ASPCL Protein transport protein sec13 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec13 PE=3 SV=1 144 372 1.0E-07
sp|Q9T014|SPA2_ARATH Protein SPA1-RELATED 2 OS=Arabidopsis thaliana GN=SPA2 PE=1 SV=2 183 412 1.0E-07
sp|A1DHK2|SEC31_NEOFI Protein transport protein sec31 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sec31 PE=3 SV=1 186 419 1.0E-07
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 183 362 1.0E-07
sp|Q7RZF5|SEC13_NEUCR Protein transport protein sec13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nup-20 PE=3 SV=2 279 416 1.0E-07
sp|Q25189|GBLP_HYDVU Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 187 421 1.0E-07
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 186 417 1.0E-07
sp|Q6DUZ9|TSSC1_GECJA Protein TSSC1 OS=Gecko japonicus GN=TSSC1 PE=2 SV=1 196 423 1.0E-07
sp|Q75C26|CIAO1_ASHGO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIA1 PE=3 SV=1 299 421 1.0E-07
sp|Q21624|CORO_CAEEL Coronin-like protein cor-1 OS=Caenorhabditis elegans GN=cor-1 PE=3 SV=2 179 362 1.0E-07
sp|O14435|GBB_CRYPA Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 184 360 1.0E-07
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 182 419 1.0E-07
sp|Q9D1M0|SEC13_MOUSE Protein SEC13 homolog OS=Mus musculus GN=Sec13 PE=1 SV=3 238 421 1.0E-07
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 203 318 1.0E-07
sp|Q5XFW8|SEC13_RAT Protein SEC13 homolog OS=Rattus norvegicus GN=Sec13 PE=1 SV=1 238 421 1.0E-07
sp|Q8TEQ6|GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens GN=GEMIN5 PE=1 SV=3 186 364 1.0E-07
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 137 419 1.0E-07
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 196 367 1.0E-07
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 187 361 2.0E-07
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 202 345 2.0E-07
sp|A4RD35|SEC31_MAGO7 Protein transport protein SEC31 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC31 PE=3 SV=1 101 362 2.0E-07
sp|Q0VC24|WDR12_BOVIN Ribosome biogenesis protein WDR12 OS=Bos taurus GN=WDR12 PE=2 SV=1 207 400 2.0E-07
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 187 360 2.0E-07
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 187 431 2.0E-07
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 180 360 2.0E-07
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 187 431 2.0E-07
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 187 431 2.0E-07
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 187 431 2.0E-07
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 187 431 2.0E-07
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 187 431 2.0E-07
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 187 431 2.0E-07
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 187 431 2.0E-07
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 185 421 2.0E-07
sp|Q8BX17|GEMI5_MOUSE Gem-associated protein 5 OS=Mus musculus GN=Gemin5 PE=1 SV=2 140 417 2.0E-07
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 286 419 2.0E-07
sp|Q32LP9|COR2A_BOVIN Coronin-2A OS=Bos taurus GN=CORO2A PE=2 SV=1 286 362 2.0E-07
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 277 419 2.0E-07
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 277 419 2.0E-07
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 277 419 2.0E-07
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 277 419 2.0E-07
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 187 367 2.0E-07
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 187 367 2.0E-07
sp|Q1DX43|SEC31_COCIM Protein transport protein SEC31 OS=Coccidioides immitis (strain RS) GN=SEC31 PE=3 SV=1 202 433 2.0E-07
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 231 419 2.0E-07
sp|P55735|SEC13_HUMAN Protein SEC13 homolog OS=Homo sapiens GN=SEC13 PE=1 SV=3 238 421 2.0E-07
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 207 362 2.0E-07
sp|Q53HC9|TSSC1_HUMAN Protein TSSC1 OS=Homo sapiens GN=TSSC1 PE=1 SV=2 260 423 2.0E-07
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 286 419 2.0E-07
sp|A2QBZ0|SEC31_ASPNC Protein transport protein sec31 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec31 PE=3 SV=1 194 433 2.0E-07
sp|B4P116|WDR12_DROYA Ribosome biogenesis protein WDR12 homolog OS=Drosophila yakuba GN=GE13328 PE=2 SV=1 207 423 2.0E-07
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 186 364 2.0E-07
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 187 360 2.0E-07
sp|C5MJE8|LIS1_CANTT Nuclear distribution protein PAC1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PAC1 PE=3 SV=1 285 364 2.0E-07
sp|Q6NX08|WDR12_DANRE Ribosome biogenesis protein wdr12 OS=Danio rerio GN=wdr12 PE=2 SV=1 182 357 2.0E-07
sp|Q92828|COR2A_HUMAN Coronin-2A OS=Homo sapiens GN=CORO2A PE=2 SV=2 241 362 2.0E-07
sp|Q92828|COR2A_HUMAN Coronin-2A OS=Homo sapiens GN=CORO2A PE=2 SV=2 150 392 2.0E-07
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 186 364 2.0E-07
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 283 418 2.0E-07
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 240 421 3.0E-07
sp|Q3TZ89|SC31B_MOUSE Protein transport protein Sec31B OS=Mus musculus GN=Sec31b PE=1 SV=2 110 354 3.0E-07
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 184 360 3.0E-07
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 207 417 3.0E-07
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 232 426 3.0E-07
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 207 417 3.0E-07
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 207 417 3.0E-07
sp|Q5RE10|TSSC1_PONAB Protein TSSC1 OS=Pongo abelii GN=TSSC1 PE=2 SV=1 260 423 3.0E-07
sp|B4HWV6|WDR12_DROSE Ribosome biogenesis protein WDR12 homolog OS=Drosophila sechellia GN=GM11446 PE=3 SV=1 207 423 3.0E-07
sp|Q8BUB4|WDFY2_MOUSE WD repeat and FYVE domain-containing protein 2 OS=Mus musculus GN=Wdfy2 PE=1 SV=2 256 362 3.0E-07
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 286 426 3.0E-07
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 184 424 3.0E-07
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 200 362 3.0E-07
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 137 421 3.0E-07
sp|Q9ULV4|COR1C_HUMAN Coronin-1C OS=Homo sapiens GN=CORO1C PE=1 SV=1 286 416 3.0E-07
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 129 418 3.0E-07
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 237 363 3.0E-07
sp|Q6NPN9|DWA2_ARATH WD repeat-containing protein DWA2 OS=Arabidopsis thaliana GN=DWA2 PE=1 SV=1 94 359 3.0E-07
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 207 363 3.0E-07
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 189 421 3.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 187 417 4.0E-07
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 248 415 4.0E-07
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 187 417 4.0E-07
sp|Q9GZL7|WDR12_HUMAN Ribosome biogenesis protein WDR12 OS=Homo sapiens GN=WDR12 PE=1 SV=2 207 400 4.0E-07
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 232 426 4.0E-07
sp|Q920M5|CORO6_MOUSE Coronin-6 OS=Mus musculus GN=Coro6 PE=1 SV=1 179 361 4.0E-07
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 207 362 4.0E-07
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 160 417 4.0E-07
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 196 364 4.0E-07
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 196 364 4.0E-07
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 240 363 4.0E-07
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 240 422 4.0E-07
sp|B3N534|WDR12_DROER Ribosome biogenesis protein WDR12 homolog OS=Drosophila erecta GN=GG10358 PE=3 SV=1 207 423 4.0E-07
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 240 363 4.0E-07
sp|Q1DZQ0|SEC13_COCIM Protein transport protein SEC13 OS=Coccidioides immitis (strain RS) GN=SEC13 PE=3 SV=1 279 412 4.0E-07
sp|P93471|COP1_PEA E3 ubiquitin-protein ligase COP1 OS=Pisum sativum GN=COP1 PE=2 SV=1 149 362 4.0E-07
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 207 417 4.0E-07
sp|Q4R571|TSSC1_MACFA Protein TSSC1 OS=Macaca fascicularis GN=TSSC1 PE=2 SV=1 260 423 4.0E-07
sp|B4Q9T6|WDR12_DROSI Ribosome biogenesis protein WDR12 homolog OS=Drosophila simulans GN=GD22226 PE=3 SV=1 207 423 4.0E-07
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 186 364 4.0E-07
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 177 363 4.0E-07
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 240 421 5.0E-07
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 202 418 5.0E-07
sp|Q0CYG9|SEC31_ASPTN Protein transport protein sec31 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec31 PE=3 SV=1 202 433 5.0E-07
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 207 367 5.0E-07
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 202 421 5.0E-07
sp|Q5ZLG9|WDR59_CHICK WD repeat-containing protein 59 OS=Gallus gallus GN=WDR59 PE=2 SV=1 151 382 5.0E-07
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 202 420 5.0E-07
sp|Q3ZCC9|SEC13_BOVIN Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 SV=1 304 416 5.0E-07
sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 196 422 5.0E-07
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 207 417 5.0E-07
sp|Q5REE6|WDR12_PONAB Ribosome biogenesis protein WDR12 OS=Pongo abelii GN=WDR12 PE=2 SV=1 207 400 6.0E-07
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 180 417 6.0E-07
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 174 360 6.0E-07
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 196 364 6.0E-07
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 137 419 6.0E-07
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 207 417 6.0E-07
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 200 362 6.0E-07
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 188 421 6.0E-07
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 181 420 6.0E-07
sp|Q38960|LWD2_ARATH WD repeat-containing protein LWD2 OS=Arabidopsis thaliana GN=LWD2 PE=2 SV=1 135 419 6.0E-07
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 189 417 7.0E-07
sp|Q75AV4|PFS2_ASHGO Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 207 423 7.0E-07
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 285 419 7.0E-07
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 187 360 7.0E-07
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 178 360 7.0E-07
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 187 421 7.0E-07
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 207 363 7.0E-07
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 240 363 7.0E-07
sp|Q3ZCC9|SEC13_BOVIN Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 SV=1 238 421 7.0E-07
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 254 417 7.0E-07
sp|Q9XS70|COR1B_RABIT Coronin-1B OS=Oryctolagus cuniculus GN=CORO1B PE=1 SV=1 187 370 7.0E-07
sp|Q9NQW1|SC31B_HUMAN Protein transport protein Sec31B OS=Homo sapiens GN=SEC31B PE=1 SV=1 190 419 7.0E-07
sp|Q0CCS0|CIAO1_ASPTN Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cia1 PE=3 SV=1 153 418 7.0E-07
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 182 419 8.0E-07
sp|Q7ZVL2|WDR24_DANRE WD repeat-containing protein 24 OS=Danio rerio GN=wdr24 PE=2 SV=1 136 364 8.0E-07
sp|P20053|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 220 431 8.0E-07
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 184 354 8.0E-07
sp|Q8CFJ9|WDR24_MOUSE WD repeat-containing protein 24 OS=Mus musculus GN=Wdr24 PE=1 SV=1 136 372 8.0E-07
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 240 420 8.0E-07
sp|Q25189|GBLP_HYDVU Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 137 417 8.0E-07
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 202 433 8.0E-07
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 207 437 8.0E-07
sp|Q9FUY2|LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana GN=LUG PE=1 SV=2 287 426 8.0E-07
sp|O35828|CORO7_RAT Coronin-7 OS=Rattus norvegicus GN=Coro7 PE=1 SV=2 286 361 8.0E-07
sp|Q9N4A7|SEC13_CAEEL Protein SEC13 homolog OS=Caenorhabditis elegans GN=npp-20 PE=3 SV=1 143 418 8.0E-07
sp|Q5S580|SEC31_AJECA Protein transport protein SEC31 OS=Ajellomyces capsulatus GN=SEC31 PE=1 SV=1 197 433 8.0E-07
sp|Q9AV81|PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 152 365 8.0E-07
sp|Q86HX1|HIRA_DICDI Protein HIRA OS=Dictyostelium discoideum GN=hira PE=3 SV=1 207 434 8.0E-07
sp|Q4P2B6|SEC31_USTMA Protein transport protein SEC31 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEC31 PE=3 SV=1 197 417 9.0E-07
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 189 362 9.0E-07
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 207 367 9.0E-07
sp|Q8TEQ6|GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens GN=GEMIN5 PE=1 SV=3 140 417 9.0E-07
sp|A2QBZ0|SEC31_ASPNC Protein transport protein sec31 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec31 PE=3 SV=1 190 419 9.0E-07
sp|Q4WNK7|SEC13_ASPFU Protein transport protein sec13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec13 PE=3 SV=1 154 418 9.0E-07
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 195 417 9.0E-07
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 195 417 9.0E-07
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 207 342 9.0E-07
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 181 420 9.0E-07
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 181 420 9.0E-07
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 233 363 9.0E-07
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 207 363 1.0E-06
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 152 360 1.0E-06
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 187 421 1.0E-06
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 286 426 1.0E-06
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 184 360 1.0E-06
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 211 417 1.0E-06
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 183 428 1.0E-06
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 207 362 1.0E-06
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 207 417 1.0E-06
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 203 319 1.0E-06
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 187 360 1.0E-06
sp|Q8C0P5|COR2A_MOUSE Coronin-2A OS=Mus musculus GN=Coro2a PE=2 SV=1 150 383 1.0E-06
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 207 428 1.0E-06
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 189 362 1.0E-06
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 189 362 1.0E-06
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 207 363 1.0E-06
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 207 367 1.0E-06
sp|O48847|LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 136 418 1.0E-06
sp|O35828|CORO7_RAT Coronin-7 OS=Rattus norvegicus GN=Coro7 PE=1 SV=2 290 432 1.0E-06
sp|B5DG67|WDR12_SALSA Ribosome biogenesis protein wdr12 OS=Salmo salar GN=wdr12 PE=2 SV=1 182 357 1.0E-06
sp|Q96P53|WDFY2_HUMAN WD repeat and FYVE domain-containing protein 2 OS=Homo sapiens GN=WDFY2 PE=1 SV=2 256 362 1.0E-06
sp|Q5XI13|GRWD1_RAT Glutamate-rich WD repeat-containing protein 1 OS=Rattus norvegicus GN=Grwd1 PE=2 SV=1 286 420 2.0E-06
sp|Q5XI13|GRWD1_RAT Glutamate-rich WD repeat-containing protein 1 OS=Rattus norvegicus GN=Grwd1 PE=2 SV=1 254 426 2.0E-06
sp|Q810D6|GRWD1_MOUSE Glutamate-rich WD repeat-containing protein 1 OS=Mus musculus GN=Grwd1 PE=1 SV=2 286 420 2.0E-06
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 135 350 2.0E-06
sp|Q55E54|COROB_DICDI Coronin-B OS=Dictyostelium discoideum GN=corB PE=1 SV=1 261 410 2.0E-06
sp|Q6DJD8|COR2B_XENLA Coronin-2B OS=Xenopus laevis GN=coro2b PE=2 SV=1 179 383 2.0E-06
sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 207 423 2.0E-06
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 240 363 2.0E-06
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 233 421 2.0E-06
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 233 421 2.0E-06
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 205 417 2.0E-06
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 256 361 2.0E-06
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 205 417 2.0E-06
sp|B3MJV8|WDR12_DROAN Ribosome biogenesis protein WDR12 homolog OS=Drosophila ananassae GN=GF14067 PE=3 SV=1 179 357 2.0E-06
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 256 362 2.0E-06
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 236 363 2.0E-06
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 187 428 2.0E-06
sp|B4HWV6|WDR12_DROSE Ribosome biogenesis protein WDR12 homolog OS=Drosophila sechellia GN=GM11446 PE=3 SV=1 179 340 2.0E-06
sp|Q9ULV4|COR1C_HUMAN Coronin-1C OS=Homo sapiens GN=CORO1C PE=1 SV=1 187 370 2.0E-06
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 202 418 2.0E-06
sp|B4Q9T6|WDR12_DROSI Ribosome biogenesis protein WDR12 homolog OS=Drosophila simulans GN=GD22226 PE=3 SV=1 179 340 2.0E-06
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 283 419 2.0E-06
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 207 363 3.0E-06
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 207 363 3.0E-06
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 256 362 3.0E-06
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 201 360 3.0E-06
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 201 360 3.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 186 360 3.0E-06
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 285 419 3.0E-06
sp|B4LS78|WDR12_DROVI Ribosome biogenesis protein WDR12 homolog OS=Drosophila virilis GN=GJ17641 PE=3 SV=1 179 358 3.0E-06
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 240 417 3.0E-06
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 137 417 3.0E-06
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 240 363 3.0E-06
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 207 362 3.0E-06
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 207 319 3.0E-06
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 207 362 3.0E-06
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 207 319 3.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 232 426 4.0E-06
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 200 362 4.0E-06
sp|Q29KQ0|WDR12_DROPS Ribosome biogenesis protein WDR12 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA19813 PE=3 SV=1 179 358 4.0E-06
sp|B4GT01|WDR12_DROPE Ribosome biogenesis protein WDR12 homolog OS=Drosophila persimilis GN=GL26386 PE=3 SV=1 179 357 4.0E-06
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 207 319 4.0E-06
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 166 343 4.0E-06
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 283 419 4.0E-06
sp|B3N534|WDR12_DROER Ribosome biogenesis protein WDR12 homolog OS=Drosophila erecta GN=GG10358 PE=3 SV=1 179 340 4.0E-06
sp|Q810D6|GRWD1_MOUSE Glutamate-rich WD repeat-containing protein 1 OS=Mus musculus GN=Grwd1 PE=1 SV=2 254 426 5.0E-06
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 238 363 5.0E-06
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 207 428 5.0E-06
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 207 417 5.0E-06
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 166 343 5.0E-06
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 132 414 5.0E-06
sp|B4P116|WDR12_DROYA Ribosome biogenesis protein WDR12 homolog OS=Drosophila yakuba GN=GE13328 PE=2 SV=1 179 340 5.0E-06
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 182 424 6.0E-06
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 182 361 7.0E-06
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 200 362 7.0E-06
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 285 419 7.0E-06
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 207 360 7.0E-06
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 240 421 7.0E-06
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 200 421 8.0E-06
sp|Q5ZLG9|WDR59_CHICK WD repeat-containing protein 59 OS=Gallus gallus GN=WDR59 PE=2 SV=1 196 361 8.0E-06
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 203 361 9.0E-06
sp|Q920J3|CORO6_RAT Coronin-6 OS=Rattus norvegicus GN=Coro6 PE=2 SV=2 179 330 9.0E-06
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 200 362 9.0E-06
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 176 433 1.0E-05
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 200 362 1.0E-05
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 187 360 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8403
MAPAQASDPEVDDMIQDEEDDQVERLINEEYKTWKKNSPFLYDMILGTALTWPTLTVQWFPDVKEPEGKNFRMHR
LLLGTHTSDESTNYLQIADVQIPKAVAPNPDNYDEERGEIGGYGNSGEVAALKCDIVQKIEHPGEVNKARYQPQN
PDIIATLCIDGKILIFDRTKHPLQPAVPGKINPQIELVGHKAEGFGLSWNPHEAGCLASGSEDKTMCLWDLKTLE
AESKTLRPTRKYTHHTQIVNDVQHHPIAKSFIGTVSDDQTLQIVDIRQSESNKAALVAKRGHLDAINALSFNPVA
EVLVATASADKTIGIWDLRNVKEKVHTLEGHNDAVTSLAWHPTEAGILGSGSYDRRIIFWDLSRVGEEQLPDDQD
DGPPELLFMHGGHTNHLADFSWNPNEPWLVASAAEDNLLQIWKVAESIVGKDDGDLPIDELDR*
Coding >Hirsu2|8403
ATGGCTCCCGCGCAGGCATCTGACCCTGAGGTCGACGACATGATCCAAGATGAGGAAGACGATCAGGTCGAACGC
CTGATCAACGAAGAATACAAAACTTGGAAGAAAAACAGTCCTTTCCTGTATGACATGATACTAGGCACGGCCTTG
ACCTGGCCTACCCTCACCGTCCAGTGGTTCCCCGACGTCAAGGAGCCCGAGGGAAAGAACTTCCGCATGCACCGT
CTTCTACTTGGTACTCATACCTCGGACGAGAGCACAAACTACCTCCAAATTGCCGATGTGCAGATCCCCAAGGCT
GTTGCGCCCAACCCCGACAACTACGACGAGGAGAGGGGGGAGATTGGCGGATACGGCAACTCTGGCGAGGTCGCC
GCCCTCAAATGCGACATTGTGCAAAAGATCGAGCACCCGGGAGAAGTCAACAAGGCCCGGTACCAACCTCAAAAC
CCCGACATCATCGCGACCTTGTGCATAGACGGCAAAATCCTCATCTTTGACCGCACGAAGCACCCTCTTCAGCCT
GCCGTGCCCGGCAAGATCAATCCTCAAATCGAGCTCGTTGGCCACAAAGCCGAAGGTTTCGGCCTCAGCTGGAAC
CCCCACGAGGCGGGCTGTCTGGCCTCGGGAAGCGAGGATAAGACAATGTGCTTATGGGACCTGAAGACTCTCGAG
GCGGAATCGAAGACGCTACGACCTACTCGCAAGTACACGCACCATACGCAAATCGTCAACGATGTGCAGCACCAC
CCCATAGCCAAAAGCTTCATCGGCACTGTCTCCGACGACCAGACGCTGCAGATTGTGGATATCCGACAGAGCGAG
TCGAACAAGGCCGCGCTCGTTGCCAAGCGCGGGCACCTCGATGCTATCAATGCTCTTTCTTTCAACCCTGTTGCC
GAGGTTCTCGTTGCCACTGCGTCGGCCGACAAGACAATTGGTATATGGGACCTGCGAAACGTCAAGGAAAAGGTG
CATACGCTCGAGGGCCACAACGATGCCGTGACATCTCTGGCCTGGCACCCGACGGAGGCAGGCATTCTGGGCAGC
GGAAGCTACGACAGGAGAATCATCTTTTGGGATCTGTCCCGCGTCGGCGAGGAACAGCTTCCCGATGACCAGGAC
GACGGACCCCCTGAGCTACTCTTCATGCACGGCGGGCACACGAATCATCTGGCCGACTTTAGCTGGAACCCCAAC
GAGCCGTGGCTCGTGGCGAGTGCTGCCGAAGACAATCTGCTGCAAATCTGGAAGGTAGCAGAGTCCATTGTCGGT
AAGGACGATGGGGACTTGCCCATTGATGAGCTTGACCGATAG
Transcript >Hirsu2|8403
ATGGCTCCCGCGCAGGCATCTGACCCTGAGGTCGACGACATGATCCAAGATGAGGAAGACGATCAGGTCGAACGC
CTGATCAACGAAGAATACAAAACTTGGAAGAAAAACAGTCCTTTCCTGTATGACATGATACTAGGCACGGCCTTG
ACCTGGCCTACCCTCACCGTCCAGTGGTTCCCCGACGTCAAGGAGCCCGAGGGAAAGAACTTCCGCATGCACCGT
CTTCTACTTGGTACTCATACCTCGGACGAGAGCACAAACTACCTCCAAATTGCCGATGTGCAGATCCCCAAGGCT
GTTGCGCCCAACCCCGACAACTACGACGAGGAGAGGGGGGAGATTGGCGGATACGGCAACTCTGGCGAGGTCGCC
GCCCTCAAATGCGACATTGTGCAAAAGATCGAGCACCCGGGAGAAGTCAACAAGGCCCGGTACCAACCTCAAAAC
CCCGACATCATCGCGACCTTGTGCATAGACGGCAAAATCCTCATCTTTGACCGCACGAAGCACCCTCTTCAGCCT
GCCGTGCCCGGCAAGATCAATCCTCAAATCGAGCTCGTTGGCCACAAAGCCGAAGGTTTCGGCCTCAGCTGGAAC
CCCCACGAGGCGGGCTGTCTGGCCTCGGGAAGCGAGGATAAGACAATGTGCTTATGGGACCTGAAGACTCTCGAG
GCGGAATCGAAGACGCTACGACCTACTCGCAAGTACACGCACCATACGCAAATCGTCAACGATGTGCAGCACCAC
CCCATAGCCAAAAGCTTCATCGGCACTGTCTCCGACGACCAGACGCTGCAGATTGTGGATATCCGACAGAGCGAG
TCGAACAAGGCCGCGCTCGTTGCCAAGCGCGGGCACCTCGATGCTATCAATGCTCTTTCTTTCAACCCTGTTGCC
GAGGTTCTCGTTGCCACTGCGTCGGCCGACAAGACAATTGGTATATGGGACCTGCGAAACGTCAAGGAAAAGGTG
CATACGCTCGAGGGCCACAACGATGCCGTGACATCTCTGGCCTGGCACCCGACGGAGGCAGGCATTCTGGGCAGC
GGAAGCTACGACAGGAGAATCATCTTTTGGGATCTGTCCCGCGTCGGCGAGGAACAGCTTCCCGATGACCAGGAC
GACGGACCCCCTGAGCTACTCTTCATGCACGGCGGGCACACGAATCATCTGGCCGACTTTAGCTGGAACCCCAAC
GAGCCGTGGCTCGTGGCGAGTGCTGCCGAAGACAATCTGCTGCAAATCTGGAAGGTAGCAGAGTCCATTGTCGGT
AAGGACGATGGGGACTTGCCCATTGATGAGCTTGACCGATAG
Gene >Hirsu2|8403
ATGGCTCCCGCGCAGGCATCTGACCCTGAGGTCGACGGTAAGGCTGACTGACCTTCACCTCCTCTACCCAAGTCT
TCAGGACTCGCCGCGAGAGCCCGTGCGAGAATTCGAGTGGAGCCGTACTGACACACTGTATCCGATAGACATGAT
CCAAGATGAGGAAGACGATCAGGTCGAACGCCTGATCAACGAAGGTGAGCAAAAACAACCGGTCCGGCGCGAGAG
GCTACTTGTTATCTAACTCTTCCCAGAATACAAAACTTGGAAGAAAAACAGTCCTTTCCTGTATGACATGATACT
AGGGTAAGCGAGGCTGGCATCACTACGCGTTTGAAAAATCCTCTGACATGTTGCAGCACGGCCTTGACCTGGCCT
ACCCTCACCGTCCAGTGGTTCCCCGACGTCAAGGAGCCCGAGGGAAAGAACTTCCGCATGCACCGTCTTCTACTT
GGTACTCATACCTCGGACGAGAGCACAAACTACCTCCAAATTGCCGATGTGCAGATCCCCAAGGCTGTTGCGCCC
AACCCCGACAACTACGACGAGGAGAGGGGGGAGATTGGCGGATACGGCAACTCTGGCGAGGTCGCCGCCCTCAAA
TGCGACATTGTGCAAAAGATCGAGCACCCGGGAGAAGTCAACAAGGCCCGGTACCAACCTCAAAACCCCGACATC
ATCGCGACCTTGTGCATAGACGGCAAAATCCTCATCTTTGACCGCACGAAGCACCCTCTTCAGCCTGCCGTGCCC
GGCAAGATCAATCCTCAAATCGAGCTCGTTGGCCACAAAGCCGAAGGTTTCGGCCTCAGCTGGAACCCCCACGAG
GCGGGCTGTCTGGCCTCGGGAAGCGAGGATAAGACAATGTGCTTATGGTATGTAGGAGCCCAACCGACTTCCGCA
TGCTCCCGGCTAAAGAGAGGACAGGGACCTGAAGACTCTCGAGGCGGAATCGAAGACGCTACGACCTACTCGCAA
GTACACGCACCATACGCAAATCGTCAACGATGTGCAGCACCACCCCATAGCCAAAAGCTTCATCGGCACTGTCTC
CGACGACCAGACGCTGCAGATTGTGGATATCCGACAGAGCGAGTCGAACAAGGCCGCGCTCGTTGCCAAGCGCGG
GCACCTCGATGCTATCAATGCTCTTTCTTTCAACCCTGTTGCCGAGGTTCTCGTTGCCACTGCGTCGGCCGACAA
GACAATTGGTATATGGGACCTGCGAAACGTCAAGGAAAAGGTGCATACGCTCGAGGGCCACAACGATGCCGTGAC
ATCTCTGGCCTGGCACCCGACGGAGGCAGGCATTCTGGGCAGCGGAAGCTACGACAGGAGAATCATCTTTTGGGA
TCTGTCCCGCGTCGGCGAGGAACAGCTTCCCGATGACCAGGACGACGGACCCCCTGAGCTGTAGGTTACACGCGA
CGGCTCCAGTGACCAGATCCCGTCAGTGCGATGCTAACCGCTTTCTCGGTCCAGACTCTTCATGCACGGCGGGCA
CACGAATCATCTGGCCGACTTTAGCTGGAACCCCAACGAGCCGTGGCTCGTGGCGAGTGCTGCCGAAGACAATCT
GCTGCAAATCTGGAAGGTAGCAGAGTCCATTGTCGGTAAGGACGATGGGGACTTGCCCATTGATGAGCTTGACCG
ATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail