Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8399
Gene name
LocationContig_546:5993..9515
Strand-
Gene length (bp)3522
Transcript length (bp)3522
Coding sequence length (bp)3522
Protein length (aa) 1174

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 5.7E-15 31 199

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 21 199 2.0E-09
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 36 199 2.0E-08
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 36 199 2.0E-08
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 37 156 2.0E-07

GO

GO Term Description Terminal node
GO:0009405 pathogenesis Yes
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0008150 biological_process No
GO:0044421 extracellular region part No
GO:0051704 multi-organism process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0044419 interspecies interaction between organisms No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8399
MYACWVHFVPLLVILLLWPASSFAYPTDSQNQPIILYRGDTRAPEEIKFQGGFLPPINPAPHDKYRITDHIRLVA
APYGKAATPYISTTPDFIFASKFAKARARYGAKESFVYHVHATPHIFRAVDSVDQDPVTKGGAEGEYDALGGIPW
RQILGWTPIPLDTTGESLMEYLAAADQYFVRNREYDTNFDQYSASGGQPLLNERNKDPAQGKTAYDYAIDFMNRP
EIGACVGWKGEFPLFKTPDHDQKLAAARRANEEATEAAQGALAAVDRAEAALKDIEKAQSPMDAQKYAEMACIAR
DRAVKLAREVAAKSEEYIIIKSDLYEAAMGAMRRAISVAAVASKIGNIKTAKDHAKEAERLAKLKDQESAIQAIR
QAQKVYDLKGQISAKFETKLMEKDKAARVIEGHKSEIDIHPFERKPKGSPREYPDGDFVWAESRESFDGAIWWAG
QTVNEEFQQLRETLESLAKETSRADKAREKAENTLLSATRGREQTVKIEAQDHQHNTANTAKIGPNTPKAPASSK
DIITAGEQVEHLVDELPPPPRENPSRKKSAAEEKSRGSSSQPRLECCPVGKRGLLRRAACIPCPPTDSRGSSGRK
NGNRENEQGRGMEKQATRNEAQSMKSEANGERNAKTSTDKNALGQIAKAPPPPKGDPSPPTEKDVLGQVAKAPPP
PKGNPSALTEKEVLGQVAKAPPPPKGNPSAPTEKEVLSQIAKAPPPPERNPLPPTEKDVLGQIAKAPPPPKGNPS
PKTSSSLQLKSLADSTSSREFSRLIEEFGLRLPKNAAGRTLAATELHTKFKANRPALSTLKASKWGSNVALTVTT
LPWFIQDLNKMYKSDMTDLQKAAVLTSIVPLIRCSVGAAAEAEQGQVDIANLVVCYVSDALLLTPLFPIGIIIKA
VQHIAAVFIKYHKLTSLSSLQSTRDEGWQAQYKGIKEFISSEEYLSQLRNQYTASKLAVLFALAGQRELLAARWV
ELANTTQTKHHRDVQEIYEKLDAQWIKVRQETCADLRDIEHRFRTKIPNQMAGSLGTASIRYDKQFAYGYRQVTA
LEKERMLKDGIPSWTRNRLANTYDENLQALWNTRRTRNSAAVKKEVNEIQRLAKDAASKFMQPDLALCEEPPEGL
PKLPQFPVEFCEDFYFDGQCADETMYFPCSMLSRCPLLNYGSCADSRY*
Coding >Hirsu2|8399
ATGTATGCCTGCTGGGTTCACTTTGTGCCATTATTGGTGATTCTTCTCCTTTGGCCGGCCTCTAGCTTTGCTTAT
CCAACGGATTCTCAAAACCAACCAATAATCCTCTATCGTGGCGATACTCGAGCTCCGGAAGAAATCAAGTTCCAA
GGGGGGTTTCTGCCGCCTATAAACCCTGCGCCGCACGACAAATATCGCATCACCGATCATATAAGGCTTGTAGCG
GCCCCTTACGGCAAAGCTGCAACCCCTTACATCTCCACAACGCCTGATTTCATTTTCGCTTCCAAATTCGCCAAG
GCCCGTGCAAGATATGGTGCCAAAGAGTCTTTCGTCTATCACGTTCACGCGACGCCGCATATCTTCAGAGCGGTT
GATAGCGTAGACCAGGACCCTGTAACAAAGGGAGGCGCTGAGGGTGAATACGATGCGTTAGGCGGTATACCGTGG
CGGCAAATCCTTGGCTGGACCCCTATCCCCTTGGACACCACGGGTGAATCGCTTATGGAGTATTTAGCTGCGGCA
GATCAGTATTTCGTTCGCAACCGGGAATACGATACGAATTTCGATCAATATTCCGCAAGTGGCGGGCAACCTTTG
CTCAACGAGCGAAACAAAGACCCAGCCCAGGGCAAAACGGCCTACGATTACGCCATAGATTTCATGAATAGGCCC
GAAATCGGGGCTTGCGTGGGCTGGAAGGGCGAATTTCCCCTTTTCAAGACCCCCGACCATGACCAAAAACTTGCC
GCGGCAAGACGGGCAAATGAAGAAGCTACCGAAGCAGCTCAAGGTGCCTTAGCCGCAGTTGACCGTGCGGAGGCC
GCATTAAAGGATATCGAGAAGGCGCAAAGCCCGATGGACGCGCAGAAGTACGCCGAGATGGCCTGCATAGCAAGG
GATCGTGCAGTCAAACTTGCTAGAGAAGTGGCTGCCAAAAGTGAGGAGTATATCATCATCAAATCAGACCTTTAC
GAGGCAGCGATGGGTGCCATGAGGCGCGCAATCTCCGTAGCTGCCGTGGCTTCTAAGATAGGAAATATCAAAACA
GCCAAGGACCACGCGAAGGAAGCCGAACGACTTGCTAAACTAAAAGATCAGGAGTCGGCGATTCAGGCAATAAGA
CAGGCTCAAAAGGTCTACGACCTAAAAGGCCAAATTTCGGCGAAATTCGAAACCAAGCTCATGGAGAAAGACAAA
GCGGCACGCGTGATAGAAGGGCACAAATCAGAGATAGACATCCATCCATTCGAACGAAAGCCTAAGGGATCGCCA
AGGGAGTATCCTGATGGCGATTTCGTCTGGGCTGAAAGTCGAGAAAGCTTCGATGGTGCAATCTGGTGGGCGGGG
CAGACCGTCAATGAGGAGTTTCAGCAACTGAGGGAGACGCTTGAGTCCCTTGCAAAGGAGACCTCCAGGGCCGAC
AAGGCTCGAGAAAAGGCAGAAAATACGCTTCTCAGCGCGACGCGGGGAAGGGAACAGACAGTCAAGATTGAAGCT
CAAGACCATCAACACAACACAGCCAACACAGCGAAAATAGGCCCAAACACCCCGAAAGCGCCTGCCTCGAGCAAA
GACATAATCACAGCGGGTGAGCAAGTTGAGCACCTGGTCGACGAGTTACCACCACCACCCAGGGAGAATCCCTCA
AGGAAGAAGTCCGCGGCTGAAGAAAAGAGCCGAGGTTCATCAAGTCAACCACGGCTAGAGTGTTGTCCTGTCGGT
AAGAGAGGACTTTTACGGAGAGCGGCTTGCATCCCTTGCCCGCCTACAGACTCAAGAGGCTCAAGCGGCCGTAAG
AATGGCAACAGAGAGAATGAACAGGGAAGAGGAATGGAGAAGCAAGCAACCAGGAACGAAGCACAATCAATGAAA
TCAGAGGCCAATGGAGAGCGAAATGCAAAGACATCAACCGACAAGAATGCTTTAGGCCAAATCGCAAAAGCACCG
CCACCACCCAAAGGGGATCCTTCGCCGCCAACTGAGAAGGATGTTTTAGGCCAAGTCGCAAAAGCACCGCCACCA
CCTAAAGGGAATCCCTCGGCGCTGACCGAAAAGGAGGTTTTGGGCCAAGTCGCAAAGGCACCACCACCACCTAAA
GGGAATCCCTCGGCGCCGACCGAAAAGGAGGTTTTGAGCCAAATAGCAAAGGCACCACCGCCACCCGAAAGGAAT
CCCTTGCCGCCAACTGAGAAGGATGTTTTGGGCCAAATCGCGAAAGCACCGCCGCCACCCAAAGGGAACCCATCG
CCCAAGACGTCGTCGTCTCTGCAGTTGAAGAGTTTAGCCGACAGCACATCGTCCAGAGAGTTTTCGAGGCTGATC
GAGGAGTTCGGACTGCGGCTTCCGAAGAATGCTGCGGGCAGAACGCTGGCGGCAACTGAATTGCACACAAAATTT
AAAGCGAATCGCCCAGCGCTGTCAACGCTCAAGGCGTCGAAGTGGGGTTCTAATGTGGCCTTGACTGTTACTACT
CTGCCCTGGTTCATCCAAGACCTCAACAAAATGTATAAGTCGGACATGACGGACTTACAGAAAGCCGCAGTACTG
ACATCGATCGTGCCTCTCATCCGCTGTTCAGTCGGAGCTGCGGCGGAAGCAGAGCAAGGCCAAGTAGATATCGCC
AACCTCGTTGTCTGCTACGTCAGCGATGCCCTCTTACTTACGCCGCTATTTCCAATCGGTATCATCATAAAGGCT
GTACAACATATTGCAGCAGTTTTTATCAAGTATCATAAGCTAACTAGTTTATCTTCCCTGCAAAGCACACGCGAC
GAAGGGTGGCAGGCGCAATATAAAGGGATCAAAGAGTTTATTTCCTCCGAGGAATACCTTTCCCAACTGCGCAAT
CAATATACGGCTAGCAAACTAGCTGTCCTGTTTGCGCTGGCAGGCCAACGCGAATTGTTAGCTGCCCGTTGGGTT
GAGTTGGCAAATACTACGCAGACGAAACACCACAGGGACGTGCAGGAGATTTACGAGAAATTAGATGCACAGTGG
ATAAAAGTTCGTCAAGAGACATGCGCGGACCTTCGGGACATAGAGCATCGGTTTAGGACGAAAATCCCGAACCAG
ATGGCCGGTTCGTTGGGAACCGCAAGCATTCGATATGACAAACAATTTGCCTATGGGTACCGACAGGTCACGGCT
CTCGAAAAGGAGCGAATGTTGAAAGATGGGATTCCATCCTGGACTAGAAACAGACTGGCGAATACATACGACGAA
AATCTCCAGGCACTTTGGAATACCAGAAGGACTCGGAATTCAGCGGCGGTCAAGAAGGAGGTAAATGAAATCCAG
AGACTCGCCAAGGACGCCGCAAGCAAGTTTATGCAGCCTGATCTGGCCTTATGCGAAGAGCCTCCTGAGGGTTTA
CCGAAGCTCCCTCAGTTTCCCGTCGAGTTTTGCGAAGATTTCTACTTCGATGGGCAGTGCGCTGATGAGACCATG
TATTTCCCGTGCAGTATGTTGTCTCGTTGCCCTCTACTCAACTACGGGTCTTGCGCTGACAGTCGTTACTAA
Transcript >Hirsu2|8399
ATGTATGCCTGCTGGGTTCACTTTGTGCCATTATTGGTGATTCTTCTCCTTTGGCCGGCCTCTAGCTTTGCTTAT
CCAACGGATTCTCAAAACCAACCAATAATCCTCTATCGTGGCGATACTCGAGCTCCGGAAGAAATCAAGTTCCAA
GGGGGGTTTCTGCCGCCTATAAACCCTGCGCCGCACGACAAATATCGCATCACCGATCATATAAGGCTTGTAGCG
GCCCCTTACGGCAAAGCTGCAACCCCTTACATCTCCACAACGCCTGATTTCATTTTCGCTTCCAAATTCGCCAAG
GCCCGTGCAAGATATGGTGCCAAAGAGTCTTTCGTCTATCACGTTCACGCGACGCCGCATATCTTCAGAGCGGTT
GATAGCGTAGACCAGGACCCTGTAACAAAGGGAGGCGCTGAGGGTGAATACGATGCGTTAGGCGGTATACCGTGG
CGGCAAATCCTTGGCTGGACCCCTATCCCCTTGGACACCACGGGTGAATCGCTTATGGAGTATTTAGCTGCGGCA
GATCAGTATTTCGTTCGCAACCGGGAATACGATACGAATTTCGATCAATATTCCGCAAGTGGCGGGCAACCTTTG
CTCAACGAGCGAAACAAAGACCCAGCCCAGGGCAAAACGGCCTACGATTACGCCATAGATTTCATGAATAGGCCC
GAAATCGGGGCTTGCGTGGGCTGGAAGGGCGAATTTCCCCTTTTCAAGACCCCCGACCATGACCAAAAACTTGCC
GCGGCAAGACGGGCAAATGAAGAAGCTACCGAAGCAGCTCAAGGTGCCTTAGCCGCAGTTGACCGTGCGGAGGCC
GCATTAAAGGATATCGAGAAGGCGCAAAGCCCGATGGACGCGCAGAAGTACGCCGAGATGGCCTGCATAGCAAGG
GATCGTGCAGTCAAACTTGCTAGAGAAGTGGCTGCCAAAAGTGAGGAGTATATCATCATCAAATCAGACCTTTAC
GAGGCAGCGATGGGTGCCATGAGGCGCGCAATCTCCGTAGCTGCCGTGGCTTCTAAGATAGGAAATATCAAAACA
GCCAAGGACCACGCGAAGGAAGCCGAACGACTTGCTAAACTAAAAGATCAGGAGTCGGCGATTCAGGCAATAAGA
CAGGCTCAAAAGGTCTACGACCTAAAAGGCCAAATTTCGGCGAAATTCGAAACCAAGCTCATGGAGAAAGACAAA
GCGGCACGCGTGATAGAAGGGCACAAATCAGAGATAGACATCCATCCATTCGAACGAAAGCCTAAGGGATCGCCA
AGGGAGTATCCTGATGGCGATTTCGTCTGGGCTGAAAGTCGAGAAAGCTTCGATGGTGCAATCTGGTGGGCGGGG
CAGACCGTCAATGAGGAGTTTCAGCAACTGAGGGAGACGCTTGAGTCCCTTGCAAAGGAGACCTCCAGGGCCGAC
AAGGCTCGAGAAAAGGCAGAAAATACGCTTCTCAGCGCGACGCGGGGAAGGGAACAGACAGTCAAGATTGAAGCT
CAAGACCATCAACACAACACAGCCAACACAGCGAAAATAGGCCCAAACACCCCGAAAGCGCCTGCCTCGAGCAAA
GACATAATCACAGCGGGTGAGCAAGTTGAGCACCTGGTCGACGAGTTACCACCACCACCCAGGGAGAATCCCTCA
AGGAAGAAGTCCGCGGCTGAAGAAAAGAGCCGAGGTTCATCAAGTCAACCACGGCTAGAGTGTTGTCCTGTCGGT
AAGAGAGGACTTTTACGGAGAGCGGCTTGCATCCCTTGCCCGCCTACAGACTCAAGAGGCTCAAGCGGCCGTAAG
AATGGCAACAGAGAGAATGAACAGGGAAGAGGAATGGAGAAGCAAGCAACCAGGAACGAAGCACAATCAATGAAA
TCAGAGGCCAATGGAGAGCGAAATGCAAAGACATCAACCGACAAGAATGCTTTAGGCCAAATCGCAAAAGCACCG
CCACCACCCAAAGGGGATCCTTCGCCGCCAACTGAGAAGGATGTTTTAGGCCAAGTCGCAAAAGCACCGCCACCA
CCTAAAGGGAATCCCTCGGCGCTGACCGAAAAGGAGGTTTTGGGCCAAGTCGCAAAGGCACCACCACCACCTAAA
GGGAATCCCTCGGCGCCGACCGAAAAGGAGGTTTTGAGCCAAATAGCAAAGGCACCACCGCCACCCGAAAGGAAT
CCCTTGCCGCCAACTGAGAAGGATGTTTTGGGCCAAATCGCGAAAGCACCGCCGCCACCCAAAGGGAACCCATCG
CCCAAGACGTCGTCGTCTCTGCAGTTGAAGAGTTTAGCCGACAGCACATCGTCCAGAGAGTTTTCGAGGCTGATC
GAGGAGTTCGGACTGCGGCTTCCGAAGAATGCTGCGGGCAGAACGCTGGCGGCAACTGAATTGCACACAAAATTT
AAAGCGAATCGCCCAGCGCTGTCAACGCTCAAGGCGTCGAAGTGGGGTTCTAATGTGGCCTTGACTGTTACTACT
CTGCCCTGGTTCATCCAAGACCTCAACAAAATGTATAAGTCGGACATGACGGACTTACAGAAAGCCGCAGTACTG
ACATCGATCGTGCCTCTCATCCGCTGTTCAGTCGGAGCTGCGGCGGAAGCAGAGCAAGGCCAAGTAGATATCGCC
AACCTCGTTGTCTGCTACGTCAGCGATGCCCTCTTACTTACGCCGCTATTTCCAATCGGTATCATCATAAAGGCT
GTACAACATATTGCAGCAGTTTTTATCAAGTATCATAAGCTAACTAGTTTATCTTCCCTGCAAAGCACACGCGAC
GAAGGGTGGCAGGCGCAATATAAAGGGATCAAAGAGTTTATTTCCTCCGAGGAATACCTTTCCCAACTGCGCAAT
CAATATACGGCTAGCAAACTAGCTGTCCTGTTTGCGCTGGCAGGCCAACGCGAATTGTTAGCTGCCCGTTGGGTT
GAGTTGGCAAATACTACGCAGACGAAACACCACAGGGACGTGCAGGAGATTTACGAGAAATTAGATGCACAGTGG
ATAAAAGTTCGTCAAGAGACATGCGCGGACCTTCGGGACATAGAGCATCGGTTTAGGACGAAAATCCCGAACCAG
ATGGCCGGTTCGTTGGGAACCGCAAGCATTCGATATGACAAACAATTTGCCTATGGGTACCGACAGGTCACGGCT
CTCGAAAAGGAGCGAATGTTGAAAGATGGGATTCCATCCTGGACTAGAAACAGACTGGCGAATACATACGACGAA
AATCTCCAGGCACTTTGGAATACCAGAAGGACTCGGAATTCAGCGGCGGTCAAGAAGGAGGTAAATGAAATCCAG
AGACTCGCCAAGGACGCCGCAAGCAAGTTTATGCAGCCTGATCTGGCCTTATGCGAAGAGCCTCCTGAGGGTTTA
CCGAAGCTCCCTCAGTTTCCCGTCGAGTTTTGCGAAGATTTCTACTTCGATGGGCAGTGCGCTGATGAGACCATG
TATTTCCCGTGCAGTATGTTGTCTCGTTGCCCTCTACTCAACTACGGGTCTTGCGCTGACAGTCGTTACTAA
Gene >Hirsu2|8399
ATGTATGCCTGCTGGGTTCACTTTGTGCCATTATTGGTGATTCTTCTCCTTTGGCCGGCCTCTAGCTTTGCTTAT
CCAACGGATTCTCAAAACCAACCAATAATCCTCTATCGTGGCGATACTCGAGCTCCGGAAGAAATCAAGTTCCAA
GGGGGGTTTCTGCCGCCTATAAACCCTGCGCCGCACGACAAATATCGCATCACCGATCATATAAGGCTTGTAGCG
GCCCCTTACGGCAAAGCTGCAACCCCTTACATCTCCACAACGCCTGATTTCATTTTCGCTTCCAAATTCGCCAAG
GCCCGTGCAAGATATGGTGCCAAAGAGTCTTTCGTCTATCACGTTCACGCGACGCCGCATATCTTCAGAGCGGTT
GATAGCGTAGACCAGGACCCTGTAACAAAGGGAGGCGCTGAGGGTGAATACGATGCGTTAGGCGGTATACCGTGG
CGGCAAATCCTTGGCTGGACCCCTATCCCCTTGGACACCACGGGTGAATCGCTTATGGAGTATTTAGCTGCGGCA
GATCAGTATTTCGTTCGCAACCGGGAATACGATACGAATTTCGATCAATATTCCGCAAGTGGCGGGCAACCTTTG
CTCAACGAGCGAAACAAAGACCCAGCCCAGGGCAAAACGGCCTACGATTACGCCATAGATTTCATGAATAGGCCC
GAAATCGGGGCTTGCGTGGGCTGGAAGGGCGAATTTCCCCTTTTCAAGACCCCCGACCATGACCAAAAACTTGCC
GCGGCAAGACGGGCAAATGAAGAAGCTACCGAAGCAGCTCAAGGTGCCTTAGCCGCAGTTGACCGTGCGGAGGCC
GCATTAAAGGATATCGAGAAGGCGCAAAGCCCGATGGACGCGCAGAAGTACGCCGAGATGGCCTGCATAGCAAGG
GATCGTGCAGTCAAACTTGCTAGAGAAGTGGCTGCCAAAAGTGAGGAGTATATCATCATCAAATCAGACCTTTAC
GAGGCAGCGATGGGTGCCATGAGGCGCGCAATCTCCGTAGCTGCCGTGGCTTCTAAGATAGGAAATATCAAAACA
GCCAAGGACCACGCGAAGGAAGCCGAACGACTTGCTAAACTAAAAGATCAGGAGTCGGCGATTCAGGCAATAAGA
CAGGCTCAAAAGGTCTACGACCTAAAAGGCCAAATTTCGGCGAAATTCGAAACCAAGCTCATGGAGAAAGACAAA
GCGGCACGCGTGATAGAAGGGCACAAATCAGAGATAGACATCCATCCATTCGAACGAAAGCCTAAGGGATCGCCA
AGGGAGTATCCTGATGGCGATTTCGTCTGGGCTGAAAGTCGAGAAAGCTTCGATGGTGCAATCTGGTGGGCGGGG
CAGACCGTCAATGAGGAGTTTCAGCAACTGAGGGAGACGCTTGAGTCCCTTGCAAAGGAGACCTCCAGGGCCGAC
AAGGCTCGAGAAAAGGCAGAAAATACGCTTCTCAGCGCGACGCGGGGAAGGGAACAGACAGTCAAGATTGAAGCT
CAAGACCATCAACACAACACAGCCAACACAGCGAAAATAGGCCCAAACACCCCGAAAGCGCCTGCCTCGAGCAAA
GACATAATCACAGCGGGTGAGCAAGTTGAGCACCTGGTCGACGAGTTACCACCACCACCCAGGGAGAATCCCTCA
AGGAAGAAGTCCGCGGCTGAAGAAAAGAGCCGAGGTTCATCAAGTCAACCACGGCTAGAGTGTTGTCCTGTCGGT
AAGAGAGGACTTTTACGGAGAGCGGCTTGCATCCCTTGCCCGCCTACAGACTCAAGAGGCTCAAGCGGCCGTAAG
AATGGCAACAGAGAGAATGAACAGGGAAGAGGAATGGAGAAGCAAGCAACCAGGAACGAAGCACAATCAATGAAA
TCAGAGGCCAATGGAGAGCGAAATGCAAAGACATCAACCGACAAGAATGCTTTAGGCCAAATCGCAAAAGCACCG
CCACCACCCAAAGGGGATCCTTCGCCGCCAACTGAGAAGGATGTTTTAGGCCAAGTCGCAAAAGCACCGCCACCA
CCTAAAGGGAATCCCTCGGCGCTGACCGAAAAGGAGGTTTTGGGCCAAGTCGCAAAGGCACCACCACCACCTAAA
GGGAATCCCTCGGCGCCGACCGAAAAGGAGGTTTTGAGCCAAATAGCAAAGGCACCACCGCCACCCGAAAGGAAT
CCCTTGCCGCCAACTGAGAAGGATGTTTTGGGCCAAATCGCGAAAGCACCGCCGCCACCCAAAGGGAACCCATCG
CCCAAGACGTCGTCGTCTCTGCAGTTGAAGAGTTTAGCCGACAGCACATCGTCCAGAGAGTTTTCGAGGCTGATC
GAGGAGTTCGGACTGCGGCTTCCGAAGAATGCTGCGGGCAGAACGCTGGCGGCAACTGAATTGCACACAAAATTT
AAAGCGAATCGCCCAGCGCTGTCAACGCTCAAGGCGTCGAAGTGGGGTTCTAATGTGGCCTTGACTGTTACTACT
CTGCCCTGGTTCATCCAAGACCTCAACAAAATGTATAAGTCGGACATGACGGACTTACAGAAAGCCGCAGTACTG
ACATCGATCGTGCCTCTCATCCGCTGTTCAGTCGGAGCTGCGGCGGAAGCAGAGCAAGGCCAAGTAGATATCGCC
AACCTCGTTGTCTGCTACGTCAGCGATGCCCTCTTACTTACGCCGCTATTTCCAATCGGTATCATCATAAAGGCT
GTACAACATATTGCAGCAGTTTTTATCAAGTATCATAAGCTAACTAGTTTATCTTCCCTGCAAAGCACACGCGAC
GAAGGGTGGCAGGCGCAATATAAAGGGATCAAAGAGTTTATTTCCTCCGAGGAATACCTTTCCCAACTGCGCAAT
CAATATACGGCTAGCAAACTAGCTGTCCTGTTTGCGCTGGCAGGCCAACGCGAATTGTTAGCTGCCCGTTGGGTT
GAGTTGGCAAATACTACGCAGACGAAACACCACAGGGACGTGCAGGAGATTTACGAGAAATTAGATGCACAGTGG
ATAAAAGTTCGTCAAGAGACATGCGCGGACCTTCGGGACATAGAGCATCGGTTTAGGACGAAAATCCCGAACCAG
ATGGCCGGTTCGTTGGGAACCGCAAGCATTCGATATGACAAACAATTTGCCTATGGGTACCGACAGGTCACGGCT
CTCGAAAAGGAGCGAATGTTGAAAGATGGGATTCCATCCTGGACTAGAAACAGACTGGCGAATACATACGACGAA
AATCTCCAGGCACTTTGGAATACCAGAAGGACTCGGAATTCAGCGGCGGTCAAGAAGGAGGTAAATGAAATCCAG
AGACTCGCCAAGGACGCCGCAAGCAAGTTTATGCAGCCTGATCTGGCCTTATGCGAAGAGCCTCCTGAGGGTTTA
CCGAAGCTCCCTCAGTTTCCCGTCGAGTTTTGCGAAGATTTCTACTTCGATGGGCAGTGCGCTGATGAGACCATG
TATTTCCCGTGCAGTATGTTGTCTCGTTGCCCTCTACTCAACTACGGGTCTTGCGCTGACAGTCGTTACTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail