Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8398
Gene name
LocationContig_546:160..1625
Strand+
Gene length (bp)1465
Transcript length (bp)1323
Coding sequence length (bp)1323
Protein length (aa) 441

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01039 Carboxyl_trans Carboxyl transferase domain 8.6E-68 3 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2TBR0|PCCB_BOVIN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Bos taurus GN=PCCB PE=2 SV=1 4 412 2.0E-53
sp|P05166|PCCB_HUMAN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=PCCB PE=1 SV=3 4 412 1.0E-52
sp|P79384|PCCB_PIG Propionyl-CoA carboxylase beta chain, mitochondrial OS=Sus scrofa GN=PCCB PE=2 SV=1 4 412 2.0E-52
sp|Q99MN9|PCCB_MOUSE Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Pccb PE=1 SV=2 4 412 3.0E-51
sp|P07633|PCCB_RAT Propionyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Pccb PE=2 SV=1 4 412 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2TBR0|PCCB_BOVIN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Bos taurus GN=PCCB PE=2 SV=1 4 412 2.0E-53
sp|P05166|PCCB_HUMAN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=PCCB PE=1 SV=3 4 412 1.0E-52
sp|P79384|PCCB_PIG Propionyl-CoA carboxylase beta chain, mitochondrial OS=Sus scrofa GN=PCCB PE=2 SV=1 4 412 2.0E-52
sp|Q99MN9|PCCB_MOUSE Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Pccb PE=1 SV=2 4 412 3.0E-51
sp|P07633|PCCB_RAT Propionyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Pccb PE=2 SV=1 4 412 2.0E-49
sp|Q3J4E3|PCCB_RHOS4 Propionyl-CoA carboxylase beta chain OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pccB PE=1 SV=1 4 429 5.0E-48
sp|P53003|PCCB_SACEN Propionyl-CoA carboxylase beta chain OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pccB PE=3 SV=2 4 408 2.0E-47
sp|P9WQH7|PCC5_MYCTU Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accD5 PE=1 SV=1 21 408 3.0E-47
sp|O31825|YNGE_BACSU Uncharacterized carboxylase YngE OS=Bacillus subtilis (strain 168) GN=yngE PE=3 SV=2 2 408 2.0E-46
sp|P53002|PCCB_MYCLE Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium leprae (strain TN) GN=accD5 PE=3 SV=1 2 408 3.0E-46
sp|P9WQH6|PCC5_MYCTO Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accD5 PE=3 SV=1 21 408 4.0E-46
sp|Q8GBW6|12S_PROFR Methylmalonyl-CoA carboxyltransferase 12S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=3 4 430 3.0E-41
sp|P54541|PCCB_BACSU Putative propionyl-CoA carboxylase beta chain OS=Bacillus subtilis (strain 168) GN=yqjD PE=3 SV=2 4 426 4.0E-35
sp|P9WQH5|PCC6_MYCTU Probable propionyl-CoA carboxylase beta chain 6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accD6 PE=1 SV=1 102 408 1.0E-31
sp|P9WQH4|PCC6_MYCTO Probable propionyl-CoA carboxylase beta chain 6 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accD6 PE=1 SV=1 102 408 1.0E-31
sp|P63408|PCC6_MYCBO Probable propionyl-CoA carboxylase beta chain 6 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accD6 PE=3 SV=1 102 408 1.0E-31
sp|Q9LDD8|MCCB_ARATH Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana GN=MCCB PE=2 SV=1 1 410 3.0E-31
sp|Q3ULD5|MCCB_MOUSE Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Mccc2 PE=1 SV=1 1 410 2.0E-30
sp|Q5XIT9|MCCB_RAT Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Mccc2 PE=2 SV=1 1 410 3.0E-30
sp|Q9HCC0|MCCB_HUMAN Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=MCCC2 PE=1 SV=1 1 410 5.0E-28
sp|Q9V9A7|MCCB_DROME Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Drosophila melanogaster GN=l(2)04524 PE=2 SV=1 1 410 5.0E-27
sp|Q8T2J9|MCCB_DICDI Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Dictyostelium discoideum GN=mccb PE=3 SV=2 1 410 1.0E-24
sp|P34385|MCCB_CAEEL Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Caenorhabditis elegans GN=F02A9.4 PE=3 SV=1 1 410 4.0E-24
sp|Q06101|PCCB_RHOER Propionyl-CoA carboxylase beta chain OS=Rhodococcus erythropolis GN=pccB PE=3 SV=1 102 386 1.0E-19
sp|Q06700|GCDA_ACIFV Glutaconyl-CoA decarboxylase subunit alpha OS=Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4) GN=gcdA PE=1 SV=1 142 320 2.0E-08
sp|A1AVG1|ACCA_RUTMC Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Ruthia magnifica subsp. Calyptogena magnifica GN=accA PE=3 SV=1 191 341 9.0E-07
sp|Q5NEV9|ACCA_FRATT Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=accA PE=3 SV=1 228 370 2.0E-06
sp|A7N9Y7|ACCA_FRATF Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=accA PE=3 SV=1 228 370 2.0E-06
sp|Q2A5B4|ACCA_FRATH Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Francisella tularensis subsp. holarctica (strain LVS) GN=accA PE=3 SV=1 228 370 2.0E-06
sp|A0Q808|ACCA_FRATN Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Francisella tularensis subsp. novicida (strain U112) GN=accA PE=3 SV=1 228 370 2.0E-06
sp|Q0BNM6|ACCA_FRATO Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=accA PE=3 SV=1 228 370 2.0E-06
sp|A4IXL3|ACCA_FRATW Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=accA PE=3 SV=1 228 370 2.0E-06
sp|Q14GB2|ACCA_FRAT1 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=accA PE=3 SV=1 228 370 2.0E-06
sp|B2SEQ7|ACCA_FRATM Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=accA PE=3 SV=1 228 369 2.0E-06
sp|B0TXA0|ACCA_FRAP2 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=accA PE=3 SV=1 228 369 3.0E-06
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 128 248 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8398
LLTADDFSIRSGHADGASAGKTVYVEKLALALRLPVVKLVDGSSGGGSVTTIRRDGWSSLPYVPGFGSVMKQLDL
GIPNLGAVVGPAIGLGAARVVSCHFSVMAADVGSLFGAGPKVVEGATFEEGLSLQDLGGPLVHCLNGTIDNLAAD
EAGCYDQIRAVLGYLPDSGAEAPPVLPSEDPADREDVGLRSVIPRRPARSYNPRAIIESVVDRRSWFEIGALWGR
TAIGGLARLDGRPVGIVSLDCEVNGGALDAAGSQKLTRLLKLCDVMNLPVVQFVDVPGYAIGTAAERAATMRWGV
ELAKAYFATTMPIFSVVTRRVFGVAGGVMLGARDPVMQVAWPSGQWGSLPLDGGIEVGHRHELSEAEKAGRREER
YRELQDEYRRLMNPVRTANAFGVEEIIDPKDTRRICCAWAAHMYGGLMRERLANRSSGKIHPSFA*
Coding >Hirsu2|8398
CTGCTGACGGCCGACGACTTCAGCATCCGCTCGGGGCACGCCGACGGCGCCAGCGCCGGCAAGACCGTCTACGTC
GAGAAGCTGGCGCTGGCGCTGCGGCTGCCCGTCGTCAAGCTGGTCGACGGCAGCTCGGGCGGCGGCAGCGTGACG
ACGATCCGCCGCGACGGCTGGAGCTCGCTGCCGTACGTGCCCGGCTTCGGCTCCGTCATGAAGCAGCTGGACCTG
GGCATCCCGAACTTGGGGGCCGTCGTCGGCCCGGCTATCGGCCTCGGGGCCGCCCGCGTCGTCTCGTGCCACTTC
TCCGTCATGGCCGCCGACGTCGGCTCGCTCTTCGGCGCCGGCCCCAAGGTCGTCGAGGGCGCCACCTTCGAGGAG
GGCCTCAGCCTGCAGGACCTGGGCGGGCCGCTGGTCCACTGCCTCAACGGCACCATCGACAACCTGGCCGCCGAC
GAGGCCGGCTGCTACGACCAGATCCGCGCCGTGCTCGGCTACCTGCCGGACTCGGGCGCCGAGGCCCCGCCGGTG
CTGCCGTCCGAAGACCCGGCCGACCGCGAGGACGTCGGCCTGCGCAGCGTCATCCCGCGCCGGCCGGCCCGCAGC
TACAACCCGCGCGCCATCATCGAGTCCGTCGTCGACCGGCGCTCGTGGTTCGAGATCGGCGCGCTCTGGGGCCGC
ACCGCCATCGGCGGCCTCGCCCGCCTGGACGGCCGCCCGGTCGGCATCGTCTCGCTCGACTGCGAGGTCAACGGC
GGCGCGCTCGACGCGGCCGGCAGCCAGAAGCTTACACGGCTGCTCAAGCTGTGCGATGTCATGAACCTGCCTGTC
GTGCAGTTCGTCGACGTTCCCGGCTATGCCATCGGCACCGCGGCCGAACGCGCCGCCACCATGCGCTGGGGCGTC
GAGCTGGCCAAGGCCTACTTCGCGACCACGATGCCCATCTTCAGCGTCGTCACGCGCCGCGTGTTCGGCGTCGCC
GGCGGCGTCATGCTCGGCGCCCGCGATCCCGTCATGCAGGTCGCCTGGCCGTCCGGCCAATGGGGCTCCCTGCCG
CTGGACGGAGGCATCGAGGTCGGCCACCGCCACGAGCTGAGCGAGGCCGAAAAGGCCGGCCGGAGGGAGGAGCGG
TACCGGGAGCTACAGGATGAGTACCGCCGCCTGATGAACCCGGTCCGGACGGCCAATGCCTTCGGCGTCGAGGAG
ATCATCGACCCCAAGGACACGCGGCGCATCTGCTGCGCCTGGGCTGCGCACATGTACGGCGGCCTGATGCGTGAG
AGGCTGGCGAATCGGAGCTCGGGCAAGATTCATCCATCGTTCGCCTGA
Transcript >Hirsu2|8398
CTGCTGACGGCCGACGACTTCAGCATCCGCTCGGGGCACGCCGACGGCGCCAGCGCCGGCAAGACCGTCTACGTC
GAGAAGCTGGCGCTGGCGCTGCGGCTGCCCGTCGTCAAGCTGGTCGACGGCAGCTCGGGCGGCGGCAGCGTGACG
ACGATCCGCCGCGACGGCTGGAGCTCGCTGCCGTACGTGCCCGGCTTCGGCTCCGTCATGAAGCAGCTGGACCTG
GGCATCCCGAACTTGGGGGCCGTCGTCGGCCCGGCTATCGGCCTCGGGGCCGCCCGCGTCGTCTCGTGCCACTTC
TCCGTCATGGCCGCCGACGTCGGCTCGCTCTTCGGCGCCGGCCCCAAGGTCGTCGAGGGCGCCACCTTCGAGGAG
GGCCTCAGCCTGCAGGACCTGGGCGGGCCGCTGGTCCACTGCCTCAACGGCACCATCGACAACCTGGCCGCCGAC
GAGGCCGGCTGCTACGACCAGATCCGCGCCGTGCTCGGCTACCTGCCGGACTCGGGCGCCGAGGCCCCGCCGGTG
CTGCCGTCCGAAGACCCGGCCGACCGCGAGGACGTCGGCCTGCGCAGCGTCATCCCGCGCCGGCCGGCCCGCAGC
TACAACCCGCGCGCCATCATCGAGTCCGTCGTCGACCGGCGCTCGTGGTTCGAGATCGGCGCGCTCTGGGGCCGC
ACCGCCATCGGCGGCCTCGCCCGCCTGGACGGCCGCCCGGTCGGCATCGTCTCGCTCGACTGCGAGGTCAACGGC
GGCGCGCTCGACGCGGCCGGCAGCCAGAAGCTTACACGGCTGCTCAAGCTGTGCGATGTCATGAACCTGCCTGTC
GTGCAGTTCGTCGACGTTCCCGGCTATGCCATCGGCACCGCGGCCGAACGCGCCGCCACCATGCGCTGGGGCGTC
GAGCTGGCCAAGGCCTACTTCGCGACCACGATGCCCATCTTCAGCGTCGTCACGCGCCGCGTGTTCGGCGTCGCC
GGCGGCGTCATGCTCGGCGCCCGCGATCCCGTCATGCAGGTCGCCTGGCCGTCCGGCCAATGGGGCTCCCTGCCG
CTGGACGGAGGCATCGAGGTCGGCCACCGCCACGAGCTGAGCGAGGCCGAAAAGGCCGGCCGGAGGGAGGAGCGG
TACCGGGAGCTACAGGATGAGTACCGCCGCCTGATGAACCCGGTCCGGACGGCCAATGCCTTCGGCGTCGAGGAG
ATCATCGACCCCAAGGACACGCGGCGCATCTGCTGCGCCTGGGCTGCGCACATGTACGGCGGCCTGATGCGTGAG
AGGCTGGCGAATCGGAGCTCGGGCAAGATTCATCCATCGTTCGCCTGA
Gene >Hirsu2|8398
CTGCTGACGGCCGACGACTTCAGCATCCGCTCGGGGCACGCCGACGGCGCCAGCGCCGGCAAGACCGTCTACGTC
GAGAAGCTGGCGCTGGCGCTGCGGCTGCCCGTCGTCAAGCTGGTCGACGGCAGCTCGGGCGGCGGCAGCGTGACG
ACGATCCGCCGCGACGGCTGGAGCTCGCTGCCGTACGTGCCCGGCTTCGGCTCCGTCATGAAGCAGCTGGACCTG
GGCATCCCGAACTTGGGGGCCGTCGTCGGCCCGGCTGTAGGTCCCGCGCCGCCCTGCTCTTCCTGTCGTCGCCGA
GGACTCTGCCGAGGGGACAGGGGCGCTGAGCTTCTCTAGATCGGCCTCGGGGCCGCCCGCGTCGTCTCGTGCCAC
TTCTCCGTCATGGCCGCCGACGTCGGCTCGCTCTTCGGCGCCGGCCCCAAGGTCGTCGAGGGCGCCACCTTCGAG
GAGGGCCTCAGCCTGCAGGACCTGGGCGGGCCGCTGGTCCACTGCCTCAACGGCACCATCGACAACCTGGCCGCC
GACGAGGCCGGCTGCTACGACCAGATCCGCGCCGTGCTCGGCTACCTGCCGGACTCGGGCGCCGAGGCCCCGCCG
GTGCTGCCGTCCGAAGACCCGGCCGACCGCGAGGACGTCGGCCTGCGCAGCGTCATCCCGCGCCGGCCGGCCCGC
AGCTACAACCCGCGCGCCATCATCGAGTCCGTCGTCGACCGGCGCTCGTGGTTCGAGATCGGCGCGCTCTGGGGC
CGCACCGCCATCGGCGGCCTCGCCCGCCTGGACGGCCGCCCGGTCGGCATCGTCTCGCTCGACTGCGAGGTCAAC
GGCGGCGCGCTCGACGCGGCCGGCAGCCAGAAGCTTACACGGCTGCTCAAGCTGTGCGATGTCATGAACCTGCCT
GTCGTGCAGTTCGTCGACGTTCGTGAGTCTTCTCTCCCTCCCCCCTTCTCTTCCTCCGCTTCTCACAAGGCCCCG
GCCGATGACAGCCGGCTATGCCATCGGCACCGCGGCCGAACGCGCCGCCACCATGCGCTGGGGCGTCGAGCTGGC
CAAGGCCTACTTCGCGACCACGATGCCCATCTTCAGCGTCGTCACGCGCCGCGTGTTCGGCGTCGCCGGCGGCGT
CATGCTCGGCGCCCGCGATCCCGTCATGCAGGTCGCCTGGCCGTCCGGCCAATGGGGCTCCCTGCCGCTGGACGG
AGGCATCGAGGTCGGCCACCGCCACGAGCTGAGCGAGGCCGAAAAGGCCGGCCGGAGGGAGGAGCGGTACCGGGA
GCTACAGGATGAGTACCGCCGCCTGATGAACCCGGTCCGGACGGCCAATGCCTTCGGCGTCGAGGAGATCATCGA
CCCCAAGGACACGCGGCGCATCTGCTGCGCCTGGGCTGCGCACATGTACGGCGGCCTGATGCGTGAGAGGCTGGC
GAATCGGAGCTCGGGCAAGATTCATCCATCGTTCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail