Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8397
Gene name
LocationContig_545:13078..15187
Strand+
Gene length (bp)2109
Transcript length (bp)2109
Coding sequence length (bp)2109
Protein length (aa) 703

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 6.0E-31 152 628
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 4.9E-05 152 548

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25037|UBP1_YEAST Ubiquitin carboxyl-terminal hydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP1 PE=1 SV=2 152 475 1.0E-27
sp|Q02863|UBP16_YEAST Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP16 PE=1 SV=1 152 632 2.0E-15
sp|Q9FPS0|UBP27_ARATH Ubiquitin carboxyl-terminal hydrolase 27 OS=Arabidopsis thaliana GN=UBP27 PE=2 SV=1 151 544 3.0E-14
sp|P0CAQ1|UBP16_EMENI Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubp16 PE=3 SV=1 152 574 6.0E-12
sp|A2BGT0|UBP30_DANRE Ubiquitin carboxyl-terminal hydrolase 30 OS=Danio rerio GN=usp30 PE=3 SV=1 151 548 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25037|UBP1_YEAST Ubiquitin carboxyl-terminal hydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP1 PE=1 SV=2 152 475 1.0E-27
sp|Q02863|UBP16_YEAST Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP16 PE=1 SV=1 152 632 2.0E-15
sp|Q9FPS0|UBP27_ARATH Ubiquitin carboxyl-terminal hydrolase 27 OS=Arabidopsis thaliana GN=UBP27 PE=2 SV=1 151 544 3.0E-14
sp|P0CAQ1|UBP16_EMENI Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubp16 PE=3 SV=1 152 574 6.0E-12
sp|A2BGT0|UBP30_DANRE Ubiquitin carboxyl-terminal hydrolase 30 OS=Danio rerio GN=usp30 PE=3 SV=1 151 548 2.0E-07
sp|D3ZPG5|UBP30_RAT Ubiquitin carboxyl-terminal hydrolase 30 OS=Rattus norvegicus GN=Usp30 PE=3 SV=1 151 631 4.0E-07
sp|Q3UN04|UBP30_MOUSE Ubiquitin carboxyl-terminal hydrolase 30 OS=Mus musculus GN=Usp30 PE=1 SV=1 151 631 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016579 protein deubiquitination Yes
GO:0036459 thiol-dependent ubiquitinyl hydrolase activity Yes
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0008234 cysteine-type peptidase activity No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0019783 ubiquitin-like protein-specific protease activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0101005 ubiquitinyl hydrolase activity No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0070646 protein modification by small protein removal No
GO:0036211 protein modification process No
GO:0003674 molecular_function No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0006508 proteolysis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 36 55 19
2 62 84 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8397
MSSARIEFQDLYEDRVSAHRLPYARDGFWSRWNEPSVVFSVLTLVITFAIKIYGFDGSLESLLSALGLLVWDVSV
FLIPAPLLFALENRISRRTSQDDRQSTHAAKSAAMSRIVGLNSPGGVLASVSQARTRALSMTGGVLGLKPDFERP
PGLGNRDNSCYQNSILQGLAALDSFSDYLSACVRAMDSSYHGQDVARTLGGLIRDLNDSANNGRTIWTPSLLKSM
STWTQQDAQEYFSKMLDDIDKGVAKAVREARRRSGLEADCGKDEAAASQHSDDSGYQSLSPSPDLSAVKPLHNPL
EGLLAQRVACVQCGFSEGLSLIPFNCLTLNLGLDKNQHDLFERLDAYSRVESIEGVECPKCTLLKARRLLSKLMD
KMADGGAGAEQLAEPRRRLEAVERALEEDDFEEKTLTERCKISSQGKVSSTKTKQIVVARPPQSLAVHVNRSVFD
PTTFDMMKNSAPVSFPLTLDLGPWCLGSSDGADSEGSAGGGGGRTGREQWQLEPTTSMIAGDVSPSRLTGPIYEL
RAVVTHAGRHENGHYICYRKYPSRAAAEAEEAGGSGTCGAETATDEDGAAGEGEAGCGVEEASASRPAMGSNAGW
WRLSDHNVSKSDDGTVLGQAPGVFMLFYERVDASMVLQSDVEAMEGDDEDDEASGGRPGGEAERAGGGDEGREAD
GGAEETMEPENVPLPASDDGEEEVEES*
Coding >Hirsu2|8397
ATGAGTTCCGCCCGGATCGAGTTCCAAGACTTGTACGAGGATCGAGTCTCGGCTCATCGTCTGCCCTACGCACGA
GACGGCTTCTGGAGCCGTTGGAACGAGCCGAGTGTCGTCTTTTCGGTCCTGACACTCGTCATCACCTTTGCTATC
AAGATTTACGGCTTCGATGGGTCGCTCGAGAGCCTGCTAAGCGCGTTGGGACTGCTCGTGTGGGACGTCTCCGTC
TTCCTCATACCAGCACCCCTGCTCTTTGCCTTGGAGAACCGGATCTCTCGACGGACGAGCCAAGACGACCGACAG
AGCACCCATGCCGCGAAGAGCGCAGCCATGAGCAGAATCGTCGGCTTGAACAGCCCTGGCGGCGTGTTGGCGTCG
GTGTCGCAGGCGCGCACGCGGGCCCTGTCCATGACCGGGGGGGTTCTGGGCCTGAAGCCGGACTTTGAGCGACCG
CCGGGCCTCGGCAACCGAGACAATTCGTGCTACCAGAACAGCATCCTGCAGGGCCTGGCCGCTCTCGACTCCTTC
TCCGACTATCTCTCCGCCTGCGTGCGCGCCATGGACTCGTCCTACCACGGGCAGGATGTTGCCCGGACACTGGGC
GGCCTGATACGGGACCTGAACGACTCGGCGAACAATGGCAGGACGATTTGGACGCCCAGCCTGCTCAAGTCGATG
AGCACATGGACGCAACAGGACGCGCAGGAGTACTTTTCCAAAATGCTGGACGACATCGACAAGGGCGTGGCCAAG
GCCGTCCGGGAGGCGCGCCGACGTTCCGGGCTGGAGGCAGACTGCGGCAAGGACGAGGCGGCCGCGAGCCAGCAC
AGCGACGACAGCGGCTACCAGAGCCTGTCGCCGAGCCCGGACCTTTCGGCGGTGAAGCCGCTGCACAACCCGCTG
GAGGGACTGCTGGCGCAGCGGGTGGCGTGCGTCCAGTGCGGCTTCTCCGAGGGCCTGTCCCTGATACCGTTCAAC
TGCCTGACGCTGAACCTCGGGCTGGACAAGAACCAGCACGACCTCTTTGAGCGGCTGGATGCATACAGCCGGGTG
GAGAGCATCGAGGGCGTGGAGTGCCCCAAGTGCACGCTGCTCAAGGCACGGAGGCTCCTGTCGAAGCTGATGGAC
AAGATGGCGGACGGCGGCGCGGGGGCGGAGCAGCTGGCGGAGCCGCGGCGCAGGCTCGAGGCGGTCGAGAGGGCG
CTGGAGGAGGACGACTTTGAGGAGAAGACGCTGACGGAGAGATGCAAGATCTCGAGCCAGGGCAAGGTCAGCTCG
ACGAAGACGAAGCAGATCGTGGTGGCGCGGCCGCCGCAAAGCCTGGCGGTGCACGTGAACCGGTCCGTGTTCGAC
CCGACGACGTTTGACATGATGAAGAATTCGGCGCCGGTCAGCTTCCCACTGACTCTGGATCTGGGACCGTGGTGC
CTGGGCAGCTCCGACGGCGCGGACAGCGAGGGGAGCGCGGGCGGCGGCGGCGGGCGCACGGGCAGGGAGCAGTGG
CAGCTGGAGCCGACGACGTCGATGATTGCCGGCGACGTGAGCCCGTCGAGACTGACGGGGCCCATCTACGAACTG
CGGGCCGTGGTGACGCACGCGGGGAGGCACGAGAACGGACACTACATCTGCTACCGAAAGTACCCCAGCCGGGCG
GCAGCGGAGGCGGAAGAGGCCGGCGGCAGCGGGACATGCGGTGCGGAGACGGCGACGGACGAGGACGGAGCAGCG
GGCGAGGGGGAGGCGGGCTGCGGCGTCGAGGAGGCGTCGGCGTCGCGGCCGGCGATGGGCAGCAATGCTGGCTGG
TGGCGGCTCAGCGACCACAACGTGAGCAAGTCGGACGACGGGACGGTGCTGGGGCAGGCGCCGGGCGTCTTTATG
CTGTTCTACGAGCGCGTGGATGCGAGCATGGTGCTACAGAGCGACGTCGAGGCCATGGAGGGGGACGACGAGGAC
GACGAGGCGTCGGGTGGCAGGCCGGGGGGCGAGGCTGAAAGGGCGGGCGGCGGCGACGAAGGGCGGGAGGCGGAC
GGAGGTGCGGAGGAGACGATGGAGCCGGAGAATGTGCCTCTACCGGCGAGCGACGACGGGGAGGAGGAGGTGGAG
GAGAGCTGA
Transcript >Hirsu2|8397
ATGAGTTCCGCCCGGATCGAGTTCCAAGACTTGTACGAGGATCGAGTCTCGGCTCATCGTCTGCCCTACGCACGA
GACGGCTTCTGGAGCCGTTGGAACGAGCCGAGTGTCGTCTTTTCGGTCCTGACACTCGTCATCACCTTTGCTATC
AAGATTTACGGCTTCGATGGGTCGCTCGAGAGCCTGCTAAGCGCGTTGGGACTGCTCGTGTGGGACGTCTCCGTC
TTCCTCATACCAGCACCCCTGCTCTTTGCCTTGGAGAACCGGATCTCTCGACGGACGAGCCAAGACGACCGACAG
AGCACCCATGCCGCGAAGAGCGCAGCCATGAGCAGAATCGTCGGCTTGAACAGCCCTGGCGGCGTGTTGGCGTCG
GTGTCGCAGGCGCGCACGCGGGCCCTGTCCATGACCGGGGGGGTTCTGGGCCTGAAGCCGGACTTTGAGCGACCG
CCGGGCCTCGGCAACCGAGACAATTCGTGCTACCAGAACAGCATCCTGCAGGGCCTGGCCGCTCTCGACTCCTTC
TCCGACTATCTCTCCGCCTGCGTGCGCGCCATGGACTCGTCCTACCACGGGCAGGATGTTGCCCGGACACTGGGC
GGCCTGATACGGGACCTGAACGACTCGGCGAACAATGGCAGGACGATTTGGACGCCCAGCCTGCTCAAGTCGATG
AGCACATGGACGCAACAGGACGCGCAGGAGTACTTTTCCAAAATGCTGGACGACATCGACAAGGGCGTGGCCAAG
GCCGTCCGGGAGGCGCGCCGACGTTCCGGGCTGGAGGCAGACTGCGGCAAGGACGAGGCGGCCGCGAGCCAGCAC
AGCGACGACAGCGGCTACCAGAGCCTGTCGCCGAGCCCGGACCTTTCGGCGGTGAAGCCGCTGCACAACCCGCTG
GAGGGACTGCTGGCGCAGCGGGTGGCGTGCGTCCAGTGCGGCTTCTCCGAGGGCCTGTCCCTGATACCGTTCAAC
TGCCTGACGCTGAACCTCGGGCTGGACAAGAACCAGCACGACCTCTTTGAGCGGCTGGATGCATACAGCCGGGTG
GAGAGCATCGAGGGCGTGGAGTGCCCCAAGTGCACGCTGCTCAAGGCACGGAGGCTCCTGTCGAAGCTGATGGAC
AAGATGGCGGACGGCGGCGCGGGGGCGGAGCAGCTGGCGGAGCCGCGGCGCAGGCTCGAGGCGGTCGAGAGGGCG
CTGGAGGAGGACGACTTTGAGGAGAAGACGCTGACGGAGAGATGCAAGATCTCGAGCCAGGGCAAGGTCAGCTCG
ACGAAGACGAAGCAGATCGTGGTGGCGCGGCCGCCGCAAAGCCTGGCGGTGCACGTGAACCGGTCCGTGTTCGAC
CCGACGACGTTTGACATGATGAAGAATTCGGCGCCGGTCAGCTTCCCACTGACTCTGGATCTGGGACCGTGGTGC
CTGGGCAGCTCCGACGGCGCGGACAGCGAGGGGAGCGCGGGCGGCGGCGGCGGGCGCACGGGCAGGGAGCAGTGG
CAGCTGGAGCCGACGACGTCGATGATTGCCGGCGACGTGAGCCCGTCGAGACTGACGGGGCCCATCTACGAACTG
CGGGCCGTGGTGACGCACGCGGGGAGGCACGAGAACGGACACTACATCTGCTACCGAAAGTACCCCAGCCGGGCG
GCAGCGGAGGCGGAAGAGGCCGGCGGCAGCGGGACATGCGGTGCGGAGACGGCGACGGACGAGGACGGAGCAGCG
GGCGAGGGGGAGGCGGGCTGCGGCGTCGAGGAGGCGTCGGCGTCGCGGCCGGCGATGGGCAGCAATGCTGGCTGG
TGGCGGCTCAGCGACCACAACGTGAGCAAGTCGGACGACGGGACGGTGCTGGGGCAGGCGCCGGGCGTCTTTATG
CTGTTCTACGAGCGCGTGGATGCGAGCATGGTGCTACAGAGCGACGTCGAGGCCATGGAGGGGGACGACGAGGAC
GACGAGGCGTCGGGTGGCAGGCCGGGGGGCGAGGCTGAAAGGGCGGGCGGCGGCGACGAAGGGCGGGAGGCGGAC
GGAGGTGCGGAGGAGACGATGGAGCCGGAGAATGTGCCTCTACCGGCGAGCGACGACGGGGAGGAGGAGGTGGAG
GAGAGCTGA
Gene >Hirsu2|8397
ATGAGTTCCGCCCGGATCGAGTTCCAAGACTTGTACGAGGATCGAGTCTCGGCTCATCGTCTGCCCTACGCACGA
GACGGCTTCTGGAGCCGTTGGAACGAGCCGAGTGTCGTCTTTTCGGTCCTGACACTCGTCATCACCTTTGCTATC
AAGATTTACGGCTTCGATGGGTCGCTCGAGAGCCTGCTAAGCGCGTTGGGACTGCTCGTGTGGGACGTCTCCGTC
TTCCTCATACCAGCACCCCTGCTCTTTGCCTTGGAGAACCGGATCTCTCGACGGACGAGCCAAGACGACCGACAG
AGCACCCATGCCGCGAAGAGCGCAGCCATGAGCAGAATCGTCGGCTTGAACAGCCCTGGCGGCGTGTTGGCGTCG
GTGTCGCAGGCGCGCACGCGGGCCCTGTCCATGACCGGGGGGGTTCTGGGCCTGAAGCCGGACTTTGAGCGACCG
CCGGGCCTCGGCAACCGAGACAATTCGTGCTACCAGAACAGCATCCTGCAGGGCCTGGCCGCTCTCGACTCCTTC
TCCGACTATCTCTCCGCCTGCGTGCGCGCCATGGACTCGTCCTACCACGGGCAGGATGTTGCCCGGACACTGGGC
GGCCTGATACGGGACCTGAACGACTCGGCGAACAATGGCAGGACGATTTGGACGCCCAGCCTGCTCAAGTCGATG
AGCACATGGACGCAACAGGACGCGCAGGAGTACTTTTCCAAAATGCTGGACGACATCGACAAGGGCGTGGCCAAG
GCCGTCCGGGAGGCGCGCCGACGTTCCGGGCTGGAGGCAGACTGCGGCAAGGACGAGGCGGCCGCGAGCCAGCAC
AGCGACGACAGCGGCTACCAGAGCCTGTCGCCGAGCCCGGACCTTTCGGCGGTGAAGCCGCTGCACAACCCGCTG
GAGGGACTGCTGGCGCAGCGGGTGGCGTGCGTCCAGTGCGGCTTCTCCGAGGGCCTGTCCCTGATACCGTTCAAC
TGCCTGACGCTGAACCTCGGGCTGGACAAGAACCAGCACGACCTCTTTGAGCGGCTGGATGCATACAGCCGGGTG
GAGAGCATCGAGGGCGTGGAGTGCCCCAAGTGCACGCTGCTCAAGGCACGGAGGCTCCTGTCGAAGCTGATGGAC
AAGATGGCGGACGGCGGCGCGGGGGCGGAGCAGCTGGCGGAGCCGCGGCGCAGGCTCGAGGCGGTCGAGAGGGCG
CTGGAGGAGGACGACTTTGAGGAGAAGACGCTGACGGAGAGATGCAAGATCTCGAGCCAGGGCAAGGTCAGCTCG
ACGAAGACGAAGCAGATCGTGGTGGCGCGGCCGCCGCAAAGCCTGGCGGTGCACGTGAACCGGTCCGTGTTCGAC
CCGACGACGTTTGACATGATGAAGAATTCGGCGCCGGTCAGCTTCCCACTGACTCTGGATCTGGGACCGTGGTGC
CTGGGCAGCTCCGACGGCGCGGACAGCGAGGGGAGCGCGGGCGGCGGCGGCGGGCGCACGGGCAGGGAGCAGTGG
CAGCTGGAGCCGACGACGTCGATGATTGCCGGCGACGTGAGCCCGTCGAGACTGACGGGGCCCATCTACGAACTG
CGGGCCGTGGTGACGCACGCGGGGAGGCACGAGAACGGACACTACATCTGCTACCGAAAGTACCCCAGCCGGGCG
GCAGCGGAGGCGGAAGAGGCCGGCGGCAGCGGGACATGCGGTGCGGAGACGGCGACGGACGAGGACGGAGCAGCG
GGCGAGGGGGAGGCGGGCTGCGGCGTCGAGGAGGCGTCGGCGTCGCGGCCGGCGATGGGCAGCAATGCTGGCTGG
TGGCGGCTCAGCGACCACAACGTGAGCAAGTCGGACGACGGGACGGTGCTGGGGCAGGCGCCGGGCGTCTTTATG
CTGTTCTACGAGCGCGTGGATGCGAGCATGGTGCTACAGAGCGACGTCGAGGCCATGGAGGGGGACGACGAGGAC
GACGAGGCGTCGGGTGGCAGGCCGGGGGGCGAGGCTGAAAGGGCGGGCGGCGGCGACGAAGGGCGGGAGGCGGAC
GGAGGTGCGGAGGAGACGATGGAGCCGGAGAATGTGCCTCTACCGGCGAGCGACGACGGGGAGGAGGAGGTGGAG
GAGAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail