Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8381
Gene name
LocationContig_543:491..6029
Strand-
Gene length (bp)5538
Transcript length (bp)5343
Coding sequence length (bp)5343
Protein length (aa) 1781

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 7.9E-21 919 1091
PF00271 Helicase_C Helicase conserved C-terminal domain 3.8E-13 1132 1237
PF16124 RecQ_Zn_bind RecQ zinc-binding 4.7E-15 1250 1315
PF09382 RQC RQC domain 1.4E-13 1321 1432
PF04851 ResIII Type III restriction enzyme, res subunit 1.5E-07 915 1087

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 885 1431 6.0E-157
sp|P35187|SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1 896 1431 2.0E-151
sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 898 1431 2.0E-132
sp|Q5RF63|RECQ1_PONAB ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1 898 1431 4.0E-131
sp|Q6AYJ1|RECQ1_RAT ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=1 SV=1 898 1417 1.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 885 1431 6.0E-157
sp|P35187|SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1 896 1431 2.0E-151
sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 898 1431 2.0E-132
sp|Q5RF63|RECQ1_PONAB ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1 898 1431 4.0E-131
sp|Q6AYJ1|RECQ1_RAT ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=1 SV=1 898 1417 1.0E-129
sp|Q9Z129|RECQ1_MOUSE ATP-dependent DNA helicase Q1 OS=Mus musculus GN=Recql PE=1 SV=2 898 1431 3.0E-129
sp|Q9VGI8|BLM_DROME Bloom syndrome protein homolog OS=Drosophila melanogaster GN=Blm PE=1 SV=1 911 1408 1.0E-123
sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 895 1424 5.0E-122
sp|Q9DEY9|BLM_XENLA Bloom syndrome protein homolog OS=Xenopus laevis GN=blm PE=2 SV=1 895 1418 5.0E-122
sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 895 1424 3.0E-121
sp|Q9I920|BLM_CHICK Bloom syndrome protein homolog (Fragment) OS=Gallus gallus GN=BLM PE=2 SV=1 895 1454 2.0E-120
sp|Q8L840|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1 898 1411 8.0E-120
sp|Q9TXJ8|RECQ1_CAEEL Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis elegans GN=K02F3.12 PE=3 SV=3 898 1417 2.0E-115
sp|Q9FT73|MED34_ARATH Mediator of RNA polymerase II transcription subunit 34 OS=Arabidopsis thaliana GN=MED34 PE=1 SV=1 896 1423 9.0E-115
sp|Q9FT70|RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1 898 1394 2.0E-113
sp|O18017|BLM_CAEEL Bloom syndrome protein homolog OS=Caenorhabditis elegans GN=him-6 PE=2 SV=2 894 1394 2.0E-113
sp|A8WK63|RECQ1_CAEBR Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis briggsae GN=CBG24191 PE=3 SV=1 896 1337 4.0E-113
sp|Q9FT74|RQL1_ARATH ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana GN=RECQL1 PE=2 SV=1 911 1315 1.0E-103
sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 905 1315 3.0E-94
sp|Q8VID5|RECQ5_MOUSE ATP-dependent DNA helicase Q5 OS=Mus musculus GN=Recql5 PE=1 SV=1 903 1315 4.0E-91
sp|O94762|RECQ5_HUMAN ATP-dependent DNA helicase Q5 OS=Homo sapiens GN=RECQL5 PE=1 SV=2 896 1315 5.0E-89
sp|P15043|RECQ_ECOLI ATP-dependent DNA helicase RecQ OS=Escherichia coli (strain K12) GN=recQ PE=1 SV=5 904 1318 2.0E-88
sp|D4ACP5|RECQ5_RAT ATP-dependent DNA helicase Q5 OS=Rattus norvegicus GN=Recql5 PE=1 SV=1 903 1316 3.0E-88
sp|P71359|RECQ_HAEIN ATP-dependent DNA helicase RecQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=recQ PE=3 SV=1 901 1340 1.0E-87
sp|P40724|RECQ_SALTY ATP-dependent DNA helicase RecQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=recQ PE=3 SV=3 904 1318 1.0E-87
sp|Q9CL21|RECQ_PASMU ATP-dependent DNA helicase RecQ OS=Pasteurella multocida (strain Pm70) GN=recQ PE=3 SV=1 906 1340 1.0E-86
sp|Q5UPX0|YR290_MIMIV Putative ATP-dependent RNA helicase R290 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R290 PE=3 SV=1 916 1355 4.0E-76
sp|Q19546|WRN_CAEEL Probable Werner syndrome ATP-dependent helicase homolog 1 OS=Caenorhabditis elegans GN=wrn-1 PE=3 SV=2 895 1329 7.0E-74
sp|O93530|WRN_XENLA Werner syndrome ATP-dependent helicase homolog OS=Xenopus laevis GN=wrn PE=2 SV=1 901 1319 4.0E-71
sp|O34748|RECQ_BACSU Probable ATP-dependent DNA helicase RecQ OS=Bacillus subtilis (strain 168) GN=recQ PE=3 SV=1 904 1314 1.0E-70
sp|P50729|RECS_BACSU Probable ATP-dependent DNA helicase RecS OS=Bacillus subtilis (strain 168) GN=recS PE=3 SV=1 902 1259 3.0E-67
sp|Q14191|WRN_HUMAN Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=2 907 1318 6.0E-63
sp|O09053|WRN_MOUSE Werner syndrome ATP-dependent helicase homolog OS=Mus musculus GN=Wrn PE=1 SV=3 907 1318 6.0E-63
sp|Q75NR7|RECQ4_MOUSE ATP-dependent DNA helicase Q4 OS=Mus musculus GN=Recql4 PE=2 SV=2 883 1247 2.0E-53
sp|P73421|RECQ_SYNY3 ATP-dependent DNA helicase RecQ OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=recQ PE=3 SV=1 916 1244 1.0E-52
sp|Q0WVW7|RQL5_ARATH ATP-dependent DNA helicase Q-like 5 OS=Arabidopsis thaliana GN=RECQL5 PE=2 SV=2 903 1267 2.0E-52
sp|O94761|RECQ4_HUMAN ATP-dependent DNA helicase Q4 OS=Homo sapiens GN=RECQL4 PE=1 SV=1 914 1283 3.0E-51
sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 877 1158 2.0E-37
sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 1140 1317 3.0E-29
sp|P0CT33|TLH1_SCHPO ATP-dependent DNA helicase tlh1 (Fragment) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh1 PE=3 SV=1 920 1251 2.0E-23
sp|Q1RKN3|TLH2_SCHPO ATP-dependent DNA helicase tlh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh2 PE=2 SV=1 920 1251 2.0E-23
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 920 1260 9.0E-15
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 920 1247 9.0E-13
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 920 1247 1.0E-12
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 920 1259 1.0E-12
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 920 1259 2.0E-12
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 920 1247 2.0E-12
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 920 1247 2.0E-12
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 844 1259 3.0E-12
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 920 1247 6.0E-12
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 920 1247 6.0E-12
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 892 1259 1.0E-11
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 920 1259 1.0E-11
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 834 1259 3.0E-11
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 920 1260 4.0E-11
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 920 1247 4.0E-11
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 892 1259 5.0E-11
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 920 1260 5.0E-11
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 920 1260 6.0E-11
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 920 1260 6.0E-11
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 892 1259 7.0E-11
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 909 1247 9.0E-11
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 920 1247 1.0E-10
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 920 1247 1.0E-10
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 875 1259 1.0E-10
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 901 1247 1.0E-10
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 832 1259 2.0E-10
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 920 1260 2.0E-10
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 920 1247 3.0E-10
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 920 1247 3.0E-10
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 920 1247 3.0E-10
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 920 1247 5.0E-10
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 920 1247 1.0E-09
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 920 1260 2.0E-09
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 892 1258 2.0E-09
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 864 1273 2.0E-09
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 892 1259 2.0E-09
sp|A4RN46|PRP5_MAGO7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP5 PE=3 SV=1 920 1247 3.0E-09
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 1138 1259 4.0E-09
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 920 1259 6.0E-09
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 920 1259 6.0E-09
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 920 1247 7.0E-09
sp|Q59ZH9|MAK5_CANAL ATP-dependent RNA helicase MAK5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAK5 PE=3 SV=1 920 1279 1.0E-08
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 920 1258 1.0E-08
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 890 1259 1.0E-08
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 905 1247 1.0E-08
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 920 1258 1.0E-08
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 920 1251 2.0E-08
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 920 1258 2.0E-08
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 920 1251 2.0E-08
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 920 1259 2.0E-08
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 1122 1258 2.0E-08
sp|Q98I01|UVRB_RHILO UvrABC system protein B OS=Rhizobium loti (strain MAFF303099) GN=uvrB PE=3 SV=1 1044 1273 3.0E-08
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 905 1247 3.0E-08
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 920 1259 3.0E-08
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 920 1259 3.0E-08
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 892 1259 3.0E-08
sp|Q86TM3|DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens GN=DDX53 PE=1 SV=3 920 1276 3.0E-08
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 920 1273 4.0E-08
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 920 1254 5.0E-08
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 920 1260 5.0E-08
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 928 1256 5.0E-08
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 920 1276 6.0E-08
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 906 1247 6.0E-08
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 1147 1258 6.0E-08
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 1147 1258 7.0E-08
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 920 1259 7.0E-08
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 1108 1260 7.0E-08
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 920 1247 7.0E-08
sp|Q8SQK9|DHH1_ENCCU ATP-dependent RNA helicase DHH1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DHH1 PE=3 SV=2 1147 1244 7.0E-08
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 920 1246 8.0E-08
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 890 1268 8.0E-08
sp|O13983|HRQ1_SCHPO ATP-dependent helicase hrq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrq1 PE=1 SV=4 895 1241 8.0E-08
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 900 1258 9.0E-08
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 842 1251 9.0E-08
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 892 1258 1.0E-07
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 892 1258 1.0E-07
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 920 1247 1.0E-07
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 920 1259 1.0E-07
sp|A2QFL3|DBP3_ASPNC ATP-dependent RNA helicase dbp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp3 PE=3 SV=1 928 1256 1.0E-07
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 1147 1258 1.0E-07
sp|Q6FML5|PRP5_CANGA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP5 PE=3 SV=1 902 1236 1.0E-07
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 920 1267 1.0E-07
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 1147 1280 1.0E-07
sp|Q2HEB0|PRP28_CHAGB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP28 PE=3 SV=1 1147 1260 1.0E-07
sp|Q0CLX0|PRP28_ASPTN Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp28 PE=3 SV=1 1147 1258 1.0E-07
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 1147 1258 1.0E-07
sp|Q2GUI4|DBP3_CHAGB ATP-dependent RNA helicase DBP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP3 PE=3 SV=1 1142 1251 1.0E-07
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 920 1259 1.0E-07
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 920 1247 1.0E-07
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 1147 1258 2.0E-07
sp|A6RJA2|PRP28_BOTFB Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Botryotinia fuckeliana (strain B05.10) GN=prp28 PE=3 SV=1 1147 1251 2.0E-07
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 920 1246 2.0E-07
sp|A7TEG8|MAK5_VANPO ATP-dependent RNA helicase MAK5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MAK5 PE=3 SV=1 920 1266 2.0E-07
sp|A7EGG4|PRP28_SCLS1 Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp28 PE=3 SV=1 1147 1251 2.0E-07
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 1124 1258 2.0E-07
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 920 1247 2.0E-07
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 1142 1251 2.0E-07
sp|Q12TR7|UVRB_METBU UvrABC system protein B OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=uvrB PE=3 SV=1 1120 1249 2.0E-07
sp|Q7S5R1|DBP3_NEUCR ATP-dependent RNA helicase dbp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-3 PE=3 SV=1 1147 1251 2.0E-07
sp|Q1DMX8|PRP28_COCIM Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Coccidioides immitis (strain RS) GN=PRP28 PE=3 SV=2 1147 1258 2.0E-07
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 1147 1249 2.0E-07
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 890 1273 3.0E-07
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 920 1247 3.0E-07
sp|Q55D61|IF4A_DICDI Eukaryotic initiation factor 4A OS=Dictyostelium discoideum GN=tifA PE=3 SV=1 1146 1256 3.0E-07
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 1143 1258 3.0E-07
sp|Q7SEL0|PRP28_NEUCR Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-28 PE=3 SV=1 1147 1258 3.0E-07
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 920 1258 4.0E-07
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 897 1248 4.0E-07
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 920 1322 5.0E-07
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 1119 1259 5.0E-07
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 920 1322 5.0E-07
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 920 1322 5.0E-07
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 920 1322 5.0E-07
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 920 1322 5.0E-07
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 920 1322 5.0E-07
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 920 1322 5.0E-07
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 920 1322 5.0E-07
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 920 1322 6.0E-07
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 920 1264 6.0E-07
sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 920 1247 6.0E-07
sp|Q6CX73|FAL1_KLULA ATP-dependent RNA helicase FAL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FAL1 PE=3 SV=1 1147 1258 6.0E-07
sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 920 1247 7.0E-07
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 1146 1256 7.0E-07
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 1146 1256 7.0E-07
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 920 1307 7.0E-07
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 1146 1256 7.0E-07
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 1146 1256 7.0E-07
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 1146 1256 7.0E-07
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 1146 1256 7.0E-07
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 1146 1256 7.0E-07
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 1103 1259 8.0E-07
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 1146 1258 8.0E-07
sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2 920 1247 8.0E-07
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 1146 1256 8.0E-07
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 1146 1256 9.0E-07
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 1147 1254 9.0E-07
sp|Q6FY67|MAK5_CANGA ATP-dependent RNA helicase MAK5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MAK5 PE=3 SV=1 923 1260 9.0E-07
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 1127 1259 9.0E-07
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 1146 1256 9.0E-07
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 1146 1256 9.0E-07
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 1146 1256 1.0E-06
sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A OS=Cryptosporidium parvum GN=EIF4-A PE=2 SV=1 1144 1256 1.0E-06
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 844 1259 1.0E-06
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 1128 1259 1.0E-06
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 1147 1258 1.0E-06
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 844 1259 1.0E-06
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 1128 1259 1.0E-06
sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 920 1247 1.0E-06
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 1146 1256 1.0E-06
sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 1146 1256 1.0E-06
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 1131 1258 1.0E-06
sp|Q3EBD3|RH41_ARATH DEAD-box ATP-dependent RNA helicase 41 OS=Arabidopsis thaliana GN=RH41 PE=2 SV=1 920 1260 1.0E-06
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 1103 1259 1.0E-06
sp|A7TEF4|FAL1_VANPO ATP-dependent RNA helicase FAL1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FAL1 PE=3 SV=1 1147 1258 1.0E-06
sp|Q0CLJ6|DED1_ASPTN ATP-dependent RNA helicase ded1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ded1 PE=3 SV=1 1131 1259 1.0E-06
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 920 1259 1.0E-06
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 920 1256 2.0E-06
sp|Q4I7F9|PRP28_GIBZE Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP28 PE=3 SV=1 1147 1251 2.0E-06
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 1147 1258 2.0E-06
sp|Q0E2Z7|RH41_ORYSJ DEAD-box ATP-dependent RNA helicase 41 OS=Oryza sativa subsp. japonica GN=Os02g0201900 PE=2 SV=2 920 1259 2.0E-06
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 1131 1259 2.0E-06
sp|A3N031|UVRB_ACTP2 UvrABC system protein B OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=uvrB PE=3 SV=1 1046 1237 2.0E-06
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 1140 1256 2.0E-06
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 928 1247 2.0E-06
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 1095 1259 2.0E-06
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 1147 1302 2.0E-06
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 1147 1302 2.0E-06
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 1145 1258 2.0E-06
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 1133 1256 3.0E-06
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 920 1255 3.0E-06
sp|Q87AT6|UVRB_XYLFT UvrABC system protein B OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=uvrB PE=3 SV=1 1119 1236 3.0E-06
sp|B2I8F9|UVRB_XYLF2 UvrABC system protein B OS=Xylella fastidiosa (strain M23) GN=uvrB PE=3 SV=1 1119 1236 3.0E-06
sp|B0U4J3|UVRB_XYLFM UvrABC system protein B OS=Xylella fastidiosa (strain M12) GN=uvrB PE=3 SV=1 1119 1236 3.0E-06
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 1147 1261 3.0E-06
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 1128 1256 3.0E-06
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 1136 1259 3.0E-06
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 1146 1256 3.0E-06
sp|B7IEY7|UVRB_THEAB UvrABC system protein B OS=Thermosipho africanus (strain TCF52B) GN=uvrB PE=3 SV=1 1119 1237 3.0E-06
sp|A1C595|FAL1_ASPCL ATP-dependent RNA helicase fal1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fal1 PE=3 SV=1 1146 1256 3.0E-06
sp|Q755W0|FAL1_ASHGO ATP-dependent RNA helicase FAL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FAL1 PE=3 SV=2 1147 1258 3.0E-06
sp|A6QSQ0|FAL1_AJECN ATP-dependent RNA helicase FAL1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FAL1 PE=3 SV=1 1146 1256 3.0E-06
sp|A5AAE5|FAL1_ASPNC ATP-dependent RNA helicase fal1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fal1 PE=3 SV=2 1146 1256 3.0E-06
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 1147 1249 3.0E-06
sp|Q91372|DDX4_XENLA Probable ATP-dependent RNA helicase DDX4 OS=Xenopus laevis GN=ddx4 PE=2 SV=1 890 1257 3.0E-06
sp|Q0CAS8|FAL1_ASPTN ATP-dependent RNA helicase fal1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fal1 PE=3 SV=1 1146 1256 3.0E-06
sp|A1D071|FAL1_NEOFI ATP-dependent RNA helicase fal1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fal1 PE=3 SV=1 1146 1256 3.0E-06
sp|Q5AUL4|FAL1_EMENI ATP-dependent RNA helicase fal1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fal1 PE=3 SV=1 1146 1256 4.0E-06
sp|Q2UAK1|FAL1_ASPOR ATP-dependent RNA helicase fal1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fal1 PE=3 SV=1 1146 1256 4.0E-06
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 844 1259 4.0E-06
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 920 1258 4.0E-06
sp|Q4WEB4|FAL1_ASPFU ATP-dependent RNA helicase fal1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fal1 PE=3 SV=2 1146 1256 4.0E-06
sp|Q1DTB3|FAL1_COCIM ATP-dependent RNA helicase FAL1 OS=Coccidioides immitis (strain RS) GN=FAL1 PE=3 SV=2 1146 1256 4.0E-06
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 1146 1256 4.0E-06
sp|Q64060|DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus GN=Ddx4 PE=1 SV=1 1147 1247 5.0E-06
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 920 1258 5.0E-06
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 1147 1282 5.0E-06
sp|Q8G5L9|UVRB_BIFLO UvrABC system protein B OS=Bifidobacterium longum (strain NCC 2705) GN=uvrB PE=3 SV=1 1130 1237 6.0E-06
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 1146 1256 6.0E-06
sp|A4QU31|FAL1_MAGO7 ATP-dependent RNA helicase FAL1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FAL1 PE=3 SV=1 1146 1256 6.0E-06
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 1146 1256 6.0E-06
sp|Q12099|FAL1_YEAST ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAL1 PE=1 SV=1 1147 1258 6.0E-06
sp|A6ZXY5|FAL1_YEAS7 ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FAL1 PE=3 SV=1 1147 1258 6.0E-06
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 1146 1256 6.0E-06
sp|Q2GWJ5|FAL1_CHAGB ATP-dependent RNA helicase FAL1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FAL1 PE=3 SV=1 1146 1256 6.0E-06
sp|Q4R5S7|DDX4_MACFA Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis GN=DDX4 PE=2 SV=1 1147 1247 6.0E-06
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 844 1259 7.0E-06
sp|Q9P735|FAL1_NEUCR ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fal-1 PE=3 SV=2 1146 1256 7.0E-06
sp|A1CH78|DED1_ASPCL ATP-dependent RNA helicase ded1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ded1 PE=3 SV=1 1130 1259 7.0E-06
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 1146 1256 8.0E-06
sp|Q9Z7A5|UVRB_CHLPN UvrABC system protein B OS=Chlamydia pneumoniae GN=uvrB PE=3 SV=1 1119 1274 8.0E-06
sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=1 SV=2 1147 1247 8.0E-06
sp|B7GSZ2|UVRB_BIFLS UvrABC system protein B OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=uvrB PE=3 SV=1 1130 1273 9.0E-06
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 920 1259 9.0E-06
sp|Q2UST1|MS116_ASPOR ATP-dependent RNA helicase mss116, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mss116 PE=3 SV=1 932 1256 1.0E-05
sp|Q5W5U4|DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus GN=DDX4 PE=2 SV=1 1147 1247 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0043140 ATP-dependent 3'-5' DNA helicase activity Yes
GO:0003677 DNA binding Yes
GO:0006281 DNA repair Yes
GO:0003676 nucleic acid binding Yes
GO:0006260 DNA replication Yes
GO:0016787 hydrolase activity Yes
GO:0050896 response to stimulus No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0070035 purine NTP-dependent helicase activity No
GO:0006950 response to stress No
GO:0006259 DNA metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0003678 DNA helicase activity No
GO:0016887 ATPase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0008150 biological_process No
GO:0008094 DNA-dependent ATPase activity No
GO:0036094 small molecule binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0016462 pyrophosphatase activity No
GO:0008026 ATP-dependent helicase activity No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No
GO:0004386 helicase activity No
GO:0097367 carbohydrate derivative binding No
GO:0009059 macromolecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0051716 cellular response to stimulus No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043167 ion binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0009058 biosynthetic process No
GO:0043168 anion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0017076 purine nucleotide binding No
GO:0043138 3'-5' DNA helicase activity No
GO:0004003 ATP-dependent DNA helicase activity No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8381
MYFDDSSASSPIGQRPRQICRGNLIKPVSNAGRNRKLGVPRRPIAGFMTRNNLAEHLTWLLNNVASSKPAAPSFP
SAPGPASQEAPRSQGSRQQSPEKKKPLYPVLPLSSFPSSSSSSSKPPAGPAALHSAPPRAAATHDLAGRGDVLAV
THEISVEARSMGRLTSTTKSKKPLLVSQQPQQLLTPSTTSDGRGKQRVGLTAQDAGRSAGSRLKSHVSSTPDRRL
ARLAPSPNLSLDLTDFDVDDLECMDLTAASAESLEFGDDVKLWDEKTALWSPMPAKSSKKRKGDGMSADQVVQGD
QFPDVYQILGADPPASTPRFKSSARSAAASGSAKSRRSRASKEPVEGHSVGGKRAGALQRVMEEMSSPSRRVADR
REHLGKTQTPRKHRHPEDEPASHKKRKVSPDSLSFARFSDEDTSLEVVSAARTGANDFVPDSEDEFVTPPTYSGT
TRFSEEPSNGPSVSELDRARLSVQQDVTPQDFGEPVHKRPGDGLQVTSARGGVATDTEVAAYTTSSAADSVAVET
CHPSSQTPRLLTFLSANPQALSRRHALLESHIQKNGQDFMQAINERWPREKRSEVKAEKERLLKQQCAVKELVDS
MGSYRSICEQREALAKQVAESYADGLDTDEDEFQLDELTDRVQQMEQQLLRVLSDAGLEETDFSEKTRDAPPGTR
NGSSVVFGTQPIHGSTNAAPRGSMESPFIATAGTQVVHQTQLPGASQSRTRSGGSLPAAELSSRSDFASLGREDP
SRPSLPAGAGRSKTKSASTARAPTADPDAYFDSDAEMDYGQMAEGSPPPTSRRRALQSDPRGATPRGRARPAGDD
FSDFSDDADMLAFAQDYETRQSVGASSVSSRHILLETSGNSAPAPPKARSSARRQAAPALPPLSIPPELMTHPWS
PEVQKILKDRFRMKGFRHNQLQAINATLAGEDAFVLMPTGGGKSLCYQLPAVVRTGKTRGVTIVVSPLLSLMQDQ
VDHMKALGIQAVAFNGECSAEYKRQVISAFSERSPEHFIELLYVTPEMVSKNAAFNNAMQNLHRRGKFARLVIDE
AHCVSQWGHDFRPDYKTLGQVRVKFPGVPVMALTATATQNVIVDIRHNLGMTNCQTFSQSFNRPNLYYEVRPKTT
NSDATDKIAALINAKYKNVTGIVYTISRKQAEDVAEKLCDQGITARHYHAAIDPQDKVQVQTSWQKGLVKVVVAT
IAFGMGIDKPDVRFVMHHGIPKSLEGYYQETGRAGRDGKPSDCILFFGKGDIRVLKRLIADGDGNDEQKERQMVM
LNRVTSFCDNKSDCRRTEILRYFGEDFMPAQCEKSCDNCQAGLVFEQQDFSSYAIAAIKVVQNQRRLTANQCADI
LLGKKYPNHEQQLSDDCFGMAKGLKKHELVRVIDRLSAEKAFRENNVVGNYGVAIQYLQVGPTARLFLTQQRKLM
LTIQVSDEGKGPKGKNPRAKAAKKTKTKEPPPVQSTYVSSPMDRRRGRAREEEPGDDGDVALTSNGYANDGFVIS
DNEMRDVEEEEDDDDAFGSLPDHRPARPAAARRLGPQITTDERLESLPEIHQDLVNAFVLEAQKLEEQIRNKKEL
RRPLFTERDFREMAMSWTTSIEKMGRIPGIDRDKVREHGPKLLPLLRQHHDLYREIAEANNDEGRGPGREIVDLI
SSDIDLDDGDDDDEDMAEGGPAAEASHYFNPRPEVEAFHNRLQGLSSQQQHRSSSHAAQPRTSKPPPPSSSSKGG
GRRYSGKKWQKKGGGASTRRRSQGGGRRASGSAGGAKRDGKIVKRSGGGIGLMPL*
Coding >Hirsu2|8381
ATGTACTTCGACGACAGCAGCGCCTCCTCACCGATCGGACAGCGCCCGAGACAGATCTGTCGCGGCAATCTCATC
AAGCCCGTCTCGAATGCCGGCCGGAACCGCAAGCTCGGTGTGCCCCGGCGCCCAATCGCCGGCTTCATGACTCGA
AACAACCTCGCCGAGCACCTCACCTGGCTGTTGAACAACGTCGCGTCCTCGAAGCCTGCCGCTCCATCGTTCCCC
AGCGCCCCCGGCCCTGCGTCGCAGGAGGCCCCTCGATCGCAGGGATCACGACAGCAATCGCCAGAAAAGAAGAAG
CCGCTCTACCCGGTGTTGCCGCTGTCGTCGTTTCCGTCGTCGTCGTCGTCGTCGTCGAAGCCGCCAGCTGGGCCC
GCGGCTCTCCACTCAGCACCACCCAGGGCGGCCGCGACCCATGACCTGGCCGGGCGGGGGGATGTATTGGCCGTC
ACCCACGAAATCTCAGTCGAGGCTCGCAGCATGGGCCGGCTGACATCGACTACCAAGTCCAAGAAGCCGCTCCTC
GTCTCCCAGCAGCCCCAGCAGCTGCTAACCCCATCCACCACCAGCGATGGGCGAGGGAAGCAGCGCGTTGGCCTG
ACAGCCCAGGATGCCGGGCGTTCCGCCGGCTCGCGACTCAAGTCTCATGTCTCCTCAACGCCAGATAGACGACTT
GCACGATTGGCGCCGTCGCCGAACCTCAGCCTCGACCTGACAGACTTCGATGTCGACGACCTGGAGTGCATGGAC
CTGACCGCCGCCTCGGCCGAGTCGCTCGAGTTTGGCGATGACGTCAAGCTATGGGATGAAAAGACGGCGCTGTGG
TCTCCGATGCCTGCCAAGAGCTCCAAGAAGCGGAAGGGCGACGGCATGAGCGCTGACCAGGTCGTTCAAGGCGAC
CAGTTCCCCGACGTGTACCAGATTCTTGGGGCCGATCCACCGGCGTCGACGCCAAGGTTCAAATCCTCGGCCCGT
TCCGCCGCCGCGTCCGGCAGCGCCAAGTCGCGGCGCAGCCGAGCTTCTAAAGAGCCTGTCGAGGGCCACTCTGTC
GGCGGCAAGAGGGCCGGAGCCCTTCAGCGCGTCATGGAAGAGATGTCGTCACCCTCGAGGCGGGTGGCCGACCGC
CGCGAGCATCTCGGAAAGACCCAGACGCCTCGCAAGCATCGCCACCCGGAAGACGAACCTGCAAGTCACAAGAAA
CGCAAGGTCTCCCCTGATTCCCTGTCTTTCGCTCGATTTTCAGACGAGGATACGAGTCTGGAGGTTGTGTCGGCC
GCCAGGACGGGAGCGAATGACTTCGTGCCCGACTCCGAAGACGAGTTCGTCACCCCGCCGACCTACAGCGGGACC
ACGCGATTCTCCGAGGAGCCTTCCAATGGGCCTTCCGTCAGCGAACTGGACAGAGCTCGGTTGAGTGTGCAGCAA
GACGTCACCCCCCAAGATTTCGGAGAGCCCGTTCATAAGCGTCCTGGAGACGGGCTCCAGGTAACCTCGGCGCGA
GGTGGCGTCGCTACCGACACGGAGGTTGCGGCGTACACTACTAGCAGCGCCGCTGACAGCGTGGCAGTAGAAACC
TGCCATCCTTCAAGCCAGACGCCGAGGCTTTTGACGTTCCTGTCAGCCAACCCGCAAGCTCTGAGTAGGAGACAT
GCCTTGCTAGAGTCACATATTCAAAAGAACGGCCAGGACTTCATGCAAGCGATCAATGAAAGATGGCCACGGGAG
AAGCGCAGCGAGGTCAAGGCCGAGAAGGAGCGATTACTGAAACAGCAGTGCGCCGTCAAGGAATTGGTCGACTCT
ATGGGCTCCTACCGATCGATTTGCGAACAGCGGGAGGCCTTGGCCAAGCAAGTCGCAGAATCCTACGCCGACGGG
CTCGATACAGACGAAGACGAGTTCCAGCTCGACGAGCTCACCGACCGTGTCCAGCAAATGGAGCAGCAGCTTCTG
CGTGTGCTGTCCGACGCCGGGCTGGAAGAGACAGATTTCTCCGAGAAGACGCGAGATGCTCCCCCCGGAACGCGA
AATGGAAGTTCCGTCGTCTTCGGCACGCAGCCTATCCATGGCAGCACGAATGCGGCGCCACGAGGCTCTATGGAG
TCGCCGTTCATCGCGACCGCAGGAACACAGGTGGTCCACCAGACGCAACTCCCCGGCGCATCGCAGTCTCGCACG
CGGAGCGGCGGCTCGCTTCCAGCGGCAGAACTGTCTTCGCGGAGCGATTTTGCATCTCTGGGGCGTGAGGATCCG
TCCCGACCATCGCTTCCGGCGGGCGCCGGCCGGTCCAAGACCAAGAGTGCAAGCACGGCTCGGGCCCCTACTGCC
GACCCTGACGCCTATTTCGACTCGGACGCTGAGATGGATTACGGCCAGATGGCAGAGGGGTCTCCACCGCCCACG
TCTCGCCGGCGAGCCTTACAAAGTGACCCCCGTGGAGCGACGCCACGAGGTCGCGCGCGTCCTGCGGGAGACGAT
TTCAGCGATTTCAGCGACGATGCCGACATGCTGGCTTTTGCGCAAGACTACGAAACTCGGCAGTCCGTCGGAGCC
TCGTCCGTGAGCTCGCGCCATATTCTCTTGGAGACTTCGGGAAACTCCGCGCCTGCGCCGCCCAAAGCACGCAGC
TCCGCGAGGAGACAGGCGGCGCCGGCCTTGCCCCCCCTCAGCATCCCGCCGGAGCTGATGACGCATCCGTGGTCG
CCCGAGGTGCAGAAGATACTCAAGGATCGCTTCAGGATGAAGGGCTTCCGGCACAACCAGCTGCAGGCCATCAAC
GCAACGCTGGCCGGAGAGGACGCCTTCGTGCTGATGCCCACGGGCGGCGGGAAATCGCTTTGCTACCAGCTCCCC
GCCGTGGTGAGGACGGGCAAGACCAGGGGCGTCACGATTGTCGTCTCCCCCTTGCTCAGCCTGATGCAGGACCAG
GTCGACCACATGAAGGCCTTGGGCATACAGGCTGTCGCCTTCAACGGCGAATGCTCGGCAGAGTACAAGCGGCAG
GTGATCAGCGCTTTCAGCGAGCGCAGCCCGGAGCACTTCATCGAGCTCCTCTACGTCACGCCGGAAATGGTGAGC
AAGAACGCCGCCTTCAACAACGCGATGCAGAATCTGCATCGCAGGGGAAAGTTTGCCCGGCTCGTCATCGACGAG
GCTCACTGCGTGAGCCAATGGGGACACGACTTCCGGCCGGATTACAAGACGCTCGGACAGGTGCGCGTCAAGTTC
CCCGGGGTCCCCGTCATGGCCCTCACGGCGACGGCGACGCAAAACGTCATCGTGGACATCAGGCACAACCTGGGC
ATGACGAACTGTCAGACCTTCTCGCAAAGCTTCAACCGGCCCAACCTGTACTACGAGGTCCGGCCGAAGACGACC
AACTCGGACGCGACCGACAAGATCGCCGCCTTGATCAATGCCAAGTACAAGAACGTGACGGGAATCGTCTACACC
ATCTCGAGAAAGCAGGCCGAGGACGTTGCCGAGAAGCTGTGCGATCAGGGGATAACGGCACGGCATTACCACGCG
GCCATCGACCCGCAGGACAAGGTCCAAGTGCAGACGTCCTGGCAGAAGGGGCTCGTCAAGGTGGTGGTGGCAACG
ATCGCGTTCGGCATGGGCATCGACAAGCCGGACGTGAGGTTCGTGATGCATCACGGCATCCCCAAGAGCCTGGAG
GGCTACTACCAGGAGACGGGCCGCGCCGGCCGGGACGGGAAACCCTCCGACTGCATTCTGTTCTTCGGCAAGGGG
GACATAAGGGTCCTCAAGAGGCTGATTGCGGACGGGGACGGCAACGACGAGCAGAAGGAGAGGCAGATGGTGATG
CTGAACCGCGTCACGTCCTTCTGCGACAACAAGTCGGACTGCCGGCGGACCGAGATCCTGCGCTACTTTGGAGAG
GACTTCATGCCGGCGCAGTGCGAGAAGTCGTGCGACAACTGCCAGGCCGGACTCGTCTTCGAGCAGCAGGACTTC
TCCTCATACGCCATCGCCGCCATCAAGGTGGTCCAAAACCAGCGGAGGCTGACGGCGAACCAATGCGCCGACATC
TTGCTGGGCAAGAAGTACCCGAACCACGAACAGCAGCTTTCCGACGATTGCTTCGGCATGGCTAAGGGCCTGAAG
AAGCACGAGCTGGTCCGCGTCATCGACCGGCTGTCTGCGGAGAAGGCCTTCCGCGAGAACAACGTGGTCGGCAAC
TACGGCGTGGCCATCCAGTACCTCCAGGTCGGGCCGACGGCGCGCCTGTTCCTCACACAGCAGCGCAAGCTCATG
CTCACGATCCAGGTCTCGGACGAGGGCAAGGGCCCCAAGGGGAAGAATCCCCGGGCCAAGGCCGCCAAGAAAACC
AAAACAAAGGAGCCGCCGCCAGTGCAGTCGACCTACGTGTCGTCCCCGATGGACAGACGTAGGGGCCGGGCAAGA
GAGGAGGAGCCGGGGGACGACGGCGACGTCGCCTTGACGTCGAACGGCTACGCGAACGATGGCTTCGTCATCTCG
GATAACGAGATGCGAGACGTCGAAGAAGAAGAAGACGACGACGACGCCTTCGGTTCCCTGCCCGACCATCGTCCT
GCCAGGCCGGCCGCGGCGAGAAGGCTCGGGCCACAGATCACGACCGACGAGCGGCTGGAGAGCCTTCCGGAGATA
CACCAAGACCTCGTCAACGCCTTCGTGCTGGAGGCGCAGAAGCTGGAGGAGCAGATACGCAACAAAAAGGAGCTC
AGGCGGCCGCTCTTCACCGAGCGCGACTTTCGAGAGATGGCCATGAGCTGGACAACGTCGATCGAAAAGATGGGG
CGCATCCCCGGCATCGACCGCGACAAGGTCCGCGAGCACGGGCCCAAGCTGCTGCCCCTCCTGCGACAGCACCAC
GACCTGTACCGGGAAATCGCCGAGGCGAACAACGACGAGGGCCGGGGGCCGGGCCGCGAGATCGTCGACCTGATA
AGCTCAGACATCGACCTGGACGACGGCGACGACGACGACGAAGACATGGCTGAGGGCGGACCCGCCGCCGAGGCC
TCGCACTACTTCAACCCGAGGCCCGAGGTCGAGGCCTTCCACAACCGGCTGCAGGGCCTCAGCAGCCAGCAGCAG
CACCGGTCGTCGTCGCACGCCGCCCAGCCCAGGACGTCCAAGCCGCCGCCGCCGTCGTCGTCCTCCAAGGGCGGC
GGCAGGAGGTATTCCGGCAAGAAGTGGCAGAAGAAGGGCGGCGGCGCGTCGACGCGGCGCAGGAGCCAGGGCGGA
GGGCGGAGGGCCAGCGGCTCGGCCGGCGGCGCCAAGCGGGACGGCAAGATCGTCAAGAGGTCGGGCGGCGGCATC
GGCCTGATGCCGCTGTGA
Transcript >Hirsu2|8381
ATGTACTTCGACGACAGCAGCGCCTCCTCACCGATCGGACAGCGCCCGAGACAGATCTGTCGCGGCAATCTCATC
AAGCCCGTCTCGAATGCCGGCCGGAACCGCAAGCTCGGTGTGCCCCGGCGCCCAATCGCCGGCTTCATGACTCGA
AACAACCTCGCCGAGCACCTCACCTGGCTGTTGAACAACGTCGCGTCCTCGAAGCCTGCCGCTCCATCGTTCCCC
AGCGCCCCCGGCCCTGCGTCGCAGGAGGCCCCTCGATCGCAGGGATCACGACAGCAATCGCCAGAAAAGAAGAAG
CCGCTCTACCCGGTGTTGCCGCTGTCGTCGTTTCCGTCGTCGTCGTCGTCGTCGTCGAAGCCGCCAGCTGGGCCC
GCGGCTCTCCACTCAGCACCACCCAGGGCGGCCGCGACCCATGACCTGGCCGGGCGGGGGGATGTATTGGCCGTC
ACCCACGAAATCTCAGTCGAGGCTCGCAGCATGGGCCGGCTGACATCGACTACCAAGTCCAAGAAGCCGCTCCTC
GTCTCCCAGCAGCCCCAGCAGCTGCTAACCCCATCCACCACCAGCGATGGGCGAGGGAAGCAGCGCGTTGGCCTG
ACAGCCCAGGATGCCGGGCGTTCCGCCGGCTCGCGACTCAAGTCTCATGTCTCCTCAACGCCAGATAGACGACTT
GCACGATTGGCGCCGTCGCCGAACCTCAGCCTCGACCTGACAGACTTCGATGTCGACGACCTGGAGTGCATGGAC
CTGACCGCCGCCTCGGCCGAGTCGCTCGAGTTTGGCGATGACGTCAAGCTATGGGATGAAAAGACGGCGCTGTGG
TCTCCGATGCCTGCCAAGAGCTCCAAGAAGCGGAAGGGCGACGGCATGAGCGCTGACCAGGTCGTTCAAGGCGAC
CAGTTCCCCGACGTGTACCAGATTCTTGGGGCCGATCCACCGGCGTCGACGCCAAGGTTCAAATCCTCGGCCCGT
TCCGCCGCCGCGTCCGGCAGCGCCAAGTCGCGGCGCAGCCGAGCTTCTAAAGAGCCTGTCGAGGGCCACTCTGTC
GGCGGCAAGAGGGCCGGAGCCCTTCAGCGCGTCATGGAAGAGATGTCGTCACCCTCGAGGCGGGTGGCCGACCGC
CGCGAGCATCTCGGAAAGACCCAGACGCCTCGCAAGCATCGCCACCCGGAAGACGAACCTGCAAGTCACAAGAAA
CGCAAGGTCTCCCCTGATTCCCTGTCTTTCGCTCGATTTTCAGACGAGGATACGAGTCTGGAGGTTGTGTCGGCC
GCCAGGACGGGAGCGAATGACTTCGTGCCCGACTCCGAAGACGAGTTCGTCACCCCGCCGACCTACAGCGGGACC
ACGCGATTCTCCGAGGAGCCTTCCAATGGGCCTTCCGTCAGCGAACTGGACAGAGCTCGGTTGAGTGTGCAGCAA
GACGTCACCCCCCAAGATTTCGGAGAGCCCGTTCATAAGCGTCCTGGAGACGGGCTCCAGGTAACCTCGGCGCGA
GGTGGCGTCGCTACCGACACGGAGGTTGCGGCGTACACTACTAGCAGCGCCGCTGACAGCGTGGCAGTAGAAACC
TGCCATCCTTCAAGCCAGACGCCGAGGCTTTTGACGTTCCTGTCAGCCAACCCGCAAGCTCTGAGTAGGAGACAT
GCCTTGCTAGAGTCACATATTCAAAAGAACGGCCAGGACTTCATGCAAGCGATCAATGAAAGATGGCCACGGGAG
AAGCGCAGCGAGGTCAAGGCCGAGAAGGAGCGATTACTGAAACAGCAGTGCGCCGTCAAGGAATTGGTCGACTCT
ATGGGCTCCTACCGATCGATTTGCGAACAGCGGGAGGCCTTGGCCAAGCAAGTCGCAGAATCCTACGCCGACGGG
CTCGATACAGACGAAGACGAGTTCCAGCTCGACGAGCTCACCGACCGTGTCCAGCAAATGGAGCAGCAGCTTCTG
CGTGTGCTGTCCGACGCCGGGCTGGAAGAGACAGATTTCTCCGAGAAGACGCGAGATGCTCCCCCCGGAACGCGA
AATGGAAGTTCCGTCGTCTTCGGCACGCAGCCTATCCATGGCAGCACGAATGCGGCGCCACGAGGCTCTATGGAG
TCGCCGTTCATCGCGACCGCAGGAACACAGGTGGTCCACCAGACGCAACTCCCCGGCGCATCGCAGTCTCGCACG
CGGAGCGGCGGCTCGCTTCCAGCGGCAGAACTGTCTTCGCGGAGCGATTTTGCATCTCTGGGGCGTGAGGATCCG
TCCCGACCATCGCTTCCGGCGGGCGCCGGCCGGTCCAAGACCAAGAGTGCAAGCACGGCTCGGGCCCCTACTGCC
GACCCTGACGCCTATTTCGACTCGGACGCTGAGATGGATTACGGCCAGATGGCAGAGGGGTCTCCACCGCCCACG
TCTCGCCGGCGAGCCTTACAAAGTGACCCCCGTGGAGCGACGCCACGAGGTCGCGCGCGTCCTGCGGGAGACGAT
TTCAGCGATTTCAGCGACGATGCCGACATGCTGGCTTTTGCGCAAGACTACGAAACTCGGCAGTCCGTCGGAGCC
TCGTCCGTGAGCTCGCGCCATATTCTCTTGGAGACTTCGGGAAACTCCGCGCCTGCGCCGCCCAAAGCACGCAGC
TCCGCGAGGAGACAGGCGGCGCCGGCCTTGCCCCCCCTCAGCATCCCGCCGGAGCTGATGACGCATCCGTGGTCG
CCCGAGGTGCAGAAGATACTCAAGGATCGCTTCAGGATGAAGGGCTTCCGGCACAACCAGCTGCAGGCCATCAAC
GCAACGCTGGCCGGAGAGGACGCCTTCGTGCTGATGCCCACGGGCGGCGGGAAATCGCTTTGCTACCAGCTCCCC
GCCGTGGTGAGGACGGGCAAGACCAGGGGCGTCACGATTGTCGTCTCCCCCTTGCTCAGCCTGATGCAGGACCAG
GTCGACCACATGAAGGCCTTGGGCATACAGGCTGTCGCCTTCAACGGCGAATGCTCGGCAGAGTACAAGCGGCAG
GTGATCAGCGCTTTCAGCGAGCGCAGCCCGGAGCACTTCATCGAGCTCCTCTACGTCACGCCGGAAATGGTGAGC
AAGAACGCCGCCTTCAACAACGCGATGCAGAATCTGCATCGCAGGGGAAAGTTTGCCCGGCTCGTCATCGACGAG
GCTCACTGCGTGAGCCAATGGGGACACGACTTCCGGCCGGATTACAAGACGCTCGGACAGGTGCGCGTCAAGTTC
CCCGGGGTCCCCGTCATGGCCCTCACGGCGACGGCGACGCAAAACGTCATCGTGGACATCAGGCACAACCTGGGC
ATGACGAACTGTCAGACCTTCTCGCAAAGCTTCAACCGGCCCAACCTGTACTACGAGGTCCGGCCGAAGACGACC
AACTCGGACGCGACCGACAAGATCGCCGCCTTGATCAATGCCAAGTACAAGAACGTGACGGGAATCGTCTACACC
ATCTCGAGAAAGCAGGCCGAGGACGTTGCCGAGAAGCTGTGCGATCAGGGGATAACGGCACGGCATTACCACGCG
GCCATCGACCCGCAGGACAAGGTCCAAGTGCAGACGTCCTGGCAGAAGGGGCTCGTCAAGGTGGTGGTGGCAACG
ATCGCGTTCGGCATGGGCATCGACAAGCCGGACGTGAGGTTCGTGATGCATCACGGCATCCCCAAGAGCCTGGAG
GGCTACTACCAGGAGACGGGCCGCGCCGGCCGGGACGGGAAACCCTCCGACTGCATTCTGTTCTTCGGCAAGGGG
GACATAAGGGTCCTCAAGAGGCTGATTGCGGACGGGGACGGCAACGACGAGCAGAAGGAGAGGCAGATGGTGATG
CTGAACCGCGTCACGTCCTTCTGCGACAACAAGTCGGACTGCCGGCGGACCGAGATCCTGCGCTACTTTGGAGAG
GACTTCATGCCGGCGCAGTGCGAGAAGTCGTGCGACAACTGCCAGGCCGGACTCGTCTTCGAGCAGCAGGACTTC
TCCTCATACGCCATCGCCGCCATCAAGGTGGTCCAAAACCAGCGGAGGCTGACGGCGAACCAATGCGCCGACATC
TTGCTGGGCAAGAAGTACCCGAACCACGAACAGCAGCTTTCCGACGATTGCTTCGGCATGGCTAAGGGCCTGAAG
AAGCACGAGCTGGTCCGCGTCATCGACCGGCTGTCTGCGGAGAAGGCCTTCCGCGAGAACAACGTGGTCGGCAAC
TACGGCGTGGCCATCCAGTACCTCCAGGTCGGGCCGACGGCGCGCCTGTTCCTCACACAGCAGCGCAAGCTCATG
CTCACGATCCAGGTCTCGGACGAGGGCAAGGGCCCCAAGGGGAAGAATCCCCGGGCCAAGGCCGCCAAGAAAACC
AAAACAAAGGAGCCGCCGCCAGTGCAGTCGACCTACGTGTCGTCCCCGATGGACAGACGTAGGGGCCGGGCAAGA
GAGGAGGAGCCGGGGGACGACGGCGACGTCGCCTTGACGTCGAACGGCTACGCGAACGATGGCTTCGTCATCTCG
GATAACGAGATGCGAGACGTCGAAGAAGAAGAAGACGACGACGACGCCTTCGGTTCCCTGCCCGACCATCGTCCT
GCCAGGCCGGCCGCGGCGAGAAGGCTCGGGCCACAGATCACGACCGACGAGCGGCTGGAGAGCCTTCCGGAGATA
CACCAAGACCTCGTCAACGCCTTCGTGCTGGAGGCGCAGAAGCTGGAGGAGCAGATACGCAACAAAAAGGAGCTC
AGGCGGCCGCTCTTCACCGAGCGCGACTTTCGAGAGATGGCCATGAGCTGGACAACGTCGATCGAAAAGATGGGG
CGCATCCCCGGCATCGACCGCGACAAGGTCCGCGAGCACGGGCCCAAGCTGCTGCCCCTCCTGCGACAGCACCAC
GACCTGTACCGGGAAATCGCCGAGGCGAACAACGACGAGGGCCGGGGGCCGGGCCGCGAGATCGTCGACCTGATA
AGCTCAGACATCGACCTGGACGACGGCGACGACGACGACGAAGACATGGCTGAGGGCGGACCCGCCGCCGAGGCC
TCGCACTACTTCAACCCGAGGCCCGAGGTCGAGGCCTTCCACAACCGGCTGCAGGGCCTCAGCAGCCAGCAGCAG
CACCGGTCGTCGTCGCACGCCGCCCAGCCCAGGACGTCCAAGCCGCCGCCGCCGTCGTCGTCCTCCAAGGGCGGC
GGCAGGAGGTATTCCGGCAAGAAGTGGCAGAAGAAGGGCGGCGGCGCGTCGACGCGGCGCAGGAGCCAGGGCGGA
GGGCGGAGGGCCAGCGGCTCGGCCGGCGGCGCCAAGCGGGACGGCAAGATCGTCAAGAGGTCGGGCGGCGGCATC
GGCCTGATGCCGCTGTGA
Gene >Hirsu2|8381
ATGTACTTGTACGCTCACGTGCTACCAACTGCATTTAAGTGCGCGAATGGATCACGTGCTCTCGCATTGCTGACT
AACCGACGCGCGACGCGGAACAGCGACGACAGCAGCGCCTCCTCACCGATCGGGTCAAACCCAGACGGACAAGCT
GCCGCCGCCCGCGAACAACAGCCAGACAGCGCCCGAGACAGATCTGTCGCGGCAATCTCATCAAGCCCGTCTCGA
ATGCCGGCCGGAACCGCAAGCTCGGTGTGCCCCGGCGCCCAATCGCCGGCTTCATGACTCGAAACAACCTCGCCG
AGCACCTCACCTGGCTGTTGAACAACGTCGCGTCCTCGAAGCCTGCCGCTCCATCGTTCCCCAGCGCCCCCGGCC
CTGCGTCGCAGGAGGCCCCTCGATCGCAGGGATCACGACAGCAATCGCCAGAAAAGAAGAAGCCGCTCTACCCGG
TGTTGCCGCTGTCGTCGTTTCCGTCGTCGTCGTCGTCGTCGTCGAAGCCGCCAGCTGGGCCCGCGGCTCTCCACT
CAGCACCACCCAGGGCGGCCGCGACCCATGACCTGGCCGGGCGGGGGGATGTATTGGCCGTCACCCACGAAATCT
CAGTCGAGGCTCGCAGCATGGGCCGGCTGACATCGACTACCAAGTCCAAGAAGCCGCTCCTCGTCTCCCAGCAGC
CCCAGCAGCTGCTAACCCCATCCACCACCAGCGATGGGCGAGGGAAGCAGCGCGTTGGCCTGACAGCCCAGGATG
CCGGTCCGTACATGAAACTCCGAGTGCCGTGATCCGCGCAGTGCTGACCGTCCACCGGCAGGGCGTTCCGCCGGC
TCGCGACTCAAGTCTCATGTCTCCTCAACGCCAGATAGACGACTTGCACGATTGGCGCCGTCGCCGAACCTCAGC
CTCGACCTGACAGACTTCGATGTCGACGACCTGGAGTGCATGGACCTGACCGCCGCCTCGGCCGAGTCGCTCGAG
TTTGGCGATGACGTCAAGCTATGGGATGAAAAGACGGCGCTGTGGTCTCCGATGCCTGCCAAGAGCTCCAAGAAG
CGGAAGGGCGACGGCATGAGCGCTGACCAGGTCGTTCAAGGCGACCAGTTCCCCGACGTGTACCAGATTCTTGGG
GCCGATCCACCGGCGTCGACGCCAAGGTTCAAATCCTCGGCCCGTTCCGCCGCCGCGTCCGGCAGCGCCAAGTCG
CGGCGCAGCCGAGCTTCTAAAGAGCCTGTCGAGGGCCACTCTGTCGGCGGCAAGAGGGCCGGAGCCCTTCAGCGC
GTCATGGAAGAGATGTCGTCACCCTCGAGGCGGGTGGCCGACCGCCGCGAGCATCTCGGAAAGACCCAGACGCCT
CGCAAGCATCGCCACCCGGAAGACGAACCTGCAAGTCACAAGAAACGCAAGGTCTCCCCTGATTCCCTGTCTTTC
GCTCGATTTTCAGACGAGGATACGAGTCTGGAGGTTGTGTCGGCCGCCAGGACGGGAGCGAATGACTTCGTGCCC
GACTCCGAAGACGAGTTCGTCACCCCGCCGACCTACAGCGGGACCACGCGATTCTCCGAGGAGCCTTCCAATGGG
CCTTCCGTCAGCGAACTGGACAGAGCTCGGTTGAGTGTGCAGCAAGACGTCACCCCCCAAGATTTCGGAGAGCCC
GTTCATAAGCGTCCTGGAGACGGGCTCCAGGTAACCTCGGCGCGAGGTGGCGTCGCTACCGACACGGAGGTTGCG
GCGTACACTACTAGCAGCGCCGCTGACAGCGTGGCAGTAGAAACCTGCCATCCTTCAAGCCAGACGCCGAGGCTT
TTGACGTTCCTGTCAGCCAACCCGCAAGCTCTGAGTAGGAGACATGCCTTGCTAGAGTCACATATTCAAAAGAAC
GGCCAGGACTTCATGCAAGCGATCAATGAAAGATGGCCACGGGAGAAGCGCAGCGAGGTCAAGGCCGAGAAGGAG
CGATTACTGAAACAGCAGTGCGCCGTCAAGGAATTGGTCGACTCTATGGGCTCCTACCGATCGATTTGCGAACAG
CGGGAGGCCTTGGCCAAGCAAGTCGCAGAATCCTACGCCGACGGGCTCGATACAGACGAAGACGAGTTCCAGCTC
GACGAGCTCACCGACCGTGTCCAGCAAATGGAGCAGCAGCTTCTGCGTGTGCTGTCCGACGCCGGGCTGGAAGAG
ACAGATTTCTCCGAGAAGACGCGAGATGCTCCCCCCGGAACGCGAAATGGAAGTTCCGTCGTCTTCGGCACGCAG
CCTATCCATGGCAGCACGAATGCGGCGCCACGAGGCTCTATGGAGTCGCCGTTCATCGCGACCGCAGGAACACAG
GTGGTCCACCAGACGCAACTCCCCGGCGCATCGCAGTCTCGCACGCGGAGCGGCGGCTCGCTTCCAGCGGCAGAA
CTGTCTTCGCGGAGCGATTTTGCATCTCTGGGGCGTGAGGATCCGTCCCGACCATCGCTTCCGGCGGGCGCCGGC
CGGTCCAAGACCAAGAGTGCAAGCACGGCTCGGGCCCCTACTGCCGACCCTGACGCCTATTTCGACTCGGACGCT
GAGATGGATTACGGCCAGATGGCAGAGGGGTCTCCACCGCCCACGTCTCGCCGGCGAGCCTTACAAAGTGACCCC
CGTGGAGCGACGCCACGAGGTCGCGCGCGTCCTGCGGGAGACGATTTCAGCGATTTCAGCGACGATGCCGACATG
CTGGCTTTTGCGCAAGACTACGAAACTCGGCAGTCCGTCGGAGCCTCGTCCGTGAGCTCGCGCCATATTCTCTTG
GAGACTTCGGGAAACTCCGCGCCTGCGCCGCCCAAAGCACGCAGCTCCGCGAGGAGACAGGCGGCGCCGGCCTTG
CCCCCCCTCAGCATCCCGCCGGAGCTGATGACGCATCCGTGGTCGCCCGAGGTGCAGAAGATACTCAAGGATCGC
TTCAGGATGAAGGGCTTCCGGCACAACCAGCTGCAGGCCATCAACGCAACGCTGGCCGGAGAGGACGCCTTCGTG
CTGATGCCCACGGGCGGCGGGAAATCGCTTTGCTACCAGCTCCCCGCCGTGGTGAGGACGGGCAAGACCAGGGGC
GTCACGATTGTCGTCTCCCCCTTGCTCAGCCTGATGCAGGACCAGGTCGACCACATGAAGGCCTTGGGCATACAG
GCTGTCGCCTTCAACGGCGAATGCTCGGCAGAGTACAAGCGGCAGGTGATCAGCGCTTTCAGCGAGCGCAGCCCG
GAGCACTTCATCGAGCTCCTCTACGTCACGCCGGAAATGGTGAGCAAGAACGCCGCCTTCAACAACGCGATGCAG
AATCTGCATCGCAGGGGAAAGTTTGCCCGGCTCGTCATCGACGAGGCTCACTGCGTGAGCCAATGGGGACACGAC
TTCCGGCCGGATTACAAGACGCTCGGACAGGTGCGCGTCAAGTTCCCCGGGGTCCCCGTCATGGCCCTCACGGCG
ACGGCGACGCAAAACGTCATCGTGGACATCAGGCACAACCTGGGCATGACGAACTGTCAGACCTTCTCGCAAAGC
TTCAACCGGCCCAACCTGTACTACGAGGTCCGGCCGAAGACGACCAACTCGGACGCGACCGACAAGATCGCCGCC
TTGATCAATGCCAAGTACAAGAACGTGACGGGAATCGTCTACACCATCTCGAGAAAGCAGGCCGAGGACGTTGCC
GAGAAGCTGTGCGATCAGGGGATAACGGCACGGCATTACCACGCGGCCATCGACCCGCAGGACAAGGTCCAAGTG
CAGACGTCCTGGCAGAAGGGGCTCGTCAAGGTGGTGGTGGCAACGATCGCGTTCGGCATGGGCATCGACAAGCCG
GACGTGAGGTTCGTGATGCATCACGGCATCCCCAAGAGCCTGGAGGGCTACTACCAGGAGACGGGCCGCGCCGGC
CGGGACGGGAAACCCTCCGACTGCATTCTGTTCTTCGGCAAGGGGGACATAAGGGTCCTCAAGAGGCTGATTGCG
GACGGGGACGGCAACGACGAGCAGAAGGAGAGGCAGATGGTGATGCTGAACCGCGTCACGTCCTTCTGCGACAAC
AAGTCGGACTGCCGGCGGACCGAGATCCTGCGCTACTTTGGAGAGGACTTCATGCCGGCGCAGTGCGAGAAGTCG
TGCGACAACTGCCAGGCCGGACTCGTCTTCGAGCAGCAGGACTTCTCCTCATACGCCATCGCCGCCATCAAGGTG
GTCCAAAACCAGCGGAGGCTGACGGCGAACCAATGCGCCGACATCTTGCTGGGCAAGAAGTACCCGAACCACGAA
CAGCAGCTTTCCGACGATTGCTTCGGCATGGCTAAGGGCCTGAAGAAGCACGAGCTGGTCCGCGTCATCGACCGG
CTGTCTGCGGAGAAGGCCTTCCGCGAGAACAACGTGGTCGGCAACTACGGCGTGGCCATCCAGTACCTCCAGGTC
GGGCCGACGGCGCGCCTGTTCCTCACACAGCAGCGCAAGCTCATGCTCACGATCCAGGTCTCGGACGAGGGCAAG
GGCCCCAAGGGGAAGAATCCCCGGGCCAAGGCCGCCAAGAAAACCAAAACAAAGGAGCCGCCGCCAGTGCAGTCG
ACCTACGTGTCGTCCCCGATGGACAGACGTAGGGGCCGGGCAAGAGAGGAGGAGCCGGGGGACGACGGCGACGTC
GCCTTGACGTCGAACGGCTACGCGAACGATGGCTTCGTCATCTCGGATAACGAGATGCGAGACGTCGAAGAAGAA
GAAGACGACGACGACGCCTTCGGTTCCCTGCCCGACCATCGTCCTGCCAGGCCGGCCGCGGCGAGAAGGCTCGGG
CCACAGATCACGACCGACGAGCGGCTGGAGAGCCTTCCGGAGATACACCAAGACCTCGTCAACGCCTTCGTGCTG
GAGGCGCAGAAGCTGGAGGAGCAGATACGCAACAAAAAGGAGCTCAGGCGGCCGCTCTTCACCGAGCGCGACTTT
CGAGAGATGGCCATGAGCTGGACAACGTCGATCGAAAAGATGGGGCGCATCCCCGGCATCGACCGCGACAAGGTC
CGCGAGCACGGGCCCAAGCTGCTGCCCCTCCTGCGACAGCACCACGACCTGTACCGGGAAATCGCCGAGGCGAAC
AACGACGAGGGCCGGGGGCCGGGCCGCGAGATCGTCGACCTGATAAGCTCAGACATCGACCTGGACGACGGCGAC
GACGACGACGAAGACATGGCTGAGGGCGGACCCGCCGCCGAGGCCTCGCACTACTTCAACCCGAGGCCCGAGGTC
GAGGCCTTCCACAACCGGCTGCAGGGCCTCAGCAGCCAGCAGCAGCACCGGTCGTCGTCGCACGCCGCCCAGCCC
AGGACGTCCAAGCCGCCGCCGCCGTCGTCGTCCTCCAAGGGCGGCGGCAGGAGGTATTCCGGCAAGAAGTGGCAG
AAGAAGGGCGGCGGCGCGTCGACGCGGCGCAGGAGCCAGGGCGGAGGGCGGAGGGCCAGCGGCTCGGCCGGCGGC
GCCAAGCGGGACGGCAAGATCGTCAAGAGGTCGGGCGGCGGCATCGGCCTGATGCCGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail