Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8378
Gene name
LocationContig_542:8946..10587
Strand-
Gene length (bp)1641
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.2E-12 187 255
PF13637 Ank_4 Ankyrin repeats (many copies) 1.4E-09 196 247
PF00023 Ank Ankyrin repeat 1.9E-06 193 224
PF13606 Ank_3 Ankyrin repeat 4.8E-05 193 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7T2B9|MTPN_DANRE Myotrophin OS=Danio rerio GN=mtpn PE=3 SV=1 194 253 1.0E-07
sp|Q6P1S6|MTPN_XENTR Myotrophin OS=Xenopus tropicalis GN=mtpn PE=3 SV=1 178 255 1.0E-07
sp|Q7T0Q1|MTPN_XENLA Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 181 255 2.0E-07
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 194 255 3.0E-07
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 178 316 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7T2B9|MTPN_DANRE Myotrophin OS=Danio rerio GN=mtpn PE=3 SV=1 194 253 1.0E-07
sp|Q6P1S6|MTPN_XENTR Myotrophin OS=Xenopus tropicalis GN=mtpn PE=3 SV=1 178 255 1.0E-07
sp|Q7T0Q1|MTPN_XENLA Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 181 255 2.0E-07
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 194 255 3.0E-07
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 178 316 3.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 194 271 4.0E-07
sp|Q91955|MTPN_CHICK Myotrophin OS=Gallus gallus GN=MTPN PE=3 SV=1 194 255 6.0E-07
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 192 252 6.0E-07
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 194 252 8.0E-07
sp|Q3T0F7|MTPN_BOVIN Myotrophin OS=Bos taurus GN=MTPN PE=1 SV=3 194 255 1.0E-06
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 154 315 1.0E-06
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 194 252 1.0E-06
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 154 315 1.0E-06
sp|P62774|MTPN_MOUSE Myotrophin OS=Mus musculus GN=Mtpn PE=1 SV=2 194 255 1.0E-06
sp|P62775|MTPN_RAT Myotrophin OS=Rattus norvegicus GN=Mtpn PE=1 SV=2 194 255 1.0E-06
sp|Q863Z4|MTPN_CANLF Myotrophin OS=Canis lupus familiaris GN=MTPN PE=3 SV=3 194 255 1.0E-06
sp|P58546|MTPN_HUMAN Myotrophin OS=Homo sapiens GN=MTPN PE=1 SV=2 194 255 1.0E-06
sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 154 298 1.0E-06
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 193 252 2.0E-06
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 190 252 2.0E-06
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 130 260 2.0E-06
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 154 298 4.0E-06
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 190 252 4.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 194 261 5.0E-06
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 193 252 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8378
MATENQESTARAQWWDNGNVCIRCPRCGELHRHGFDGRYTDDNRRVSHCGPNRDGGVRGQQLEYNIRFPVGYVID
KKNVRFVAGEYEALASARNIGVSDKERVERLRHQFREQVQRRPKWTSATEIEELFEGFTAKTIGTAAAKLVLGNV
QYVRRYIETSADSNIFLHGVDSWCDNDMETGDTDVREGAVGTHGKTALHMAACEACPEMVDLLLAKGADVNAADL
NGRTPLIEAVSWGRLQNVETLLRYGADKTLPCIDRERLLLAVHCARTPEENAQSRWRPISIRGSSSFEPVSKEKA
YARNRDRERIVQLLTDGAEEPSDPELGGFDFRPVHVESGLLSSTTQYDLHDEPMTVARLYRGQGLAEVSAVSAWS
PSLSEAIQVDGRDWTPQVFQLSACLGLTMEPDKRDQGIPGQFNASHAEKQLIAYFVHKHLFLESELHIPDEPHDD
LLEQVMLLSVEERTDETIKQRQRERQRIMRERAYKIKLNQLWAARPGQSLKEAAIVCSLPVCQDCKRFVAEVNGQ
FGLALLLHHHCLDPGCPSCPR*
Coding >Hirsu2|8378
ATGGCCACAGAAAATCAGGAATCTACAGCCAGAGCTCAGTGGTGGGATAACGGCAACGTATGCATTCGGTGCCCT
CGGTGTGGCGAGCTACACCGTCACGGCTTCGATGGAAGATACACCGACGACAATCGGCGCGTGTCACACTGCGGC
CCAAACCGCGACGGCGGAGTCCGGGGTCAGCAATTGGAGTACAACATTCGATTTCCCGTCGGCTACGTCATCGAC
AAGAAGAACGTTCGATTCGTCGCCGGCGAGTATGAAGCTCTCGCATCTGCACGTAACATCGGGGTCTCGGACAAA
GAGAGGGTGGAGCGGCTGAGGCACCAGTTCAGAGAGCAAGTCCAACGAAGGCCAAAGTGGACCAGTGCGACCGAG
ATCGAGGAACTTTTCGAGGGTTTCACGGCAAAGACGATCGGCACAGCGGCGGCGAAGCTGGTGCTAGGCAATGTC
CAGTATGTTCGACGCTACATTGAGACGTCGGCCGATTCGAACATTTTCCTTCACGGAGTTGACTCGTGGTGCGAT
AACGACATGGAGACTGGAGACACGGACGTGAGAGAAGGCGCCGTTGGGACGCATGGGAAGACAGCTCTGCACATG
GCCGCGTGTGAAGCGTGTCCTGAGATGGTCGATCTTCTTCTCGCCAAGGGTGCCGATGTTAACGCGGCAGACCTC
AACGGCCGCACTCCTCTCATAGAGGCAGTTTCTTGGGGCCGCCTGCAGAACGTGGAGACTCTGCTGAGGTACGGG
GCCGACAAAACTTTGCCATGCATCGACCGGGAACGTTTGCTGCTTGCTGTCCACTGCGCGAGGACGCCGGAGGAG
AATGCACAGTCTCGCTGGCGCCCTATTTCTATACGTGGCTCCTCGAGCTTTGAGCCGGTTTCCAAGGAGAAGGCC
TACGCGAGAAACCGCGATCGAGAGCGGATTGTTCAGCTCCTTACCGATGGAGCAGAGGAACCCAGCGATCCTGAG
CTGGGCGGGTTTGATTTTCGGCCGGTCCATGTAGAGAGCGGATTGCTATCGTCAACGACCCAGTACGATCTGCAC
GACGAACCGATGACAGTGGCTCGTCTATATCGCGGTCAAGGACTGGCGGAAGTCTCTGCTGTGAGCGCCTGGTCT
CCCTCGCTAAGCGAAGCTATTCAAGTCGATGGCAGAGACTGGACGCCCCAAGTGTTTCAGTTATCTGCGTGTTTG
GGGCTCACAATGGAGCCCGACAAGCGTGACCAGGGAATTCCGGGTCAATTCAACGCAAGCCATGCCGAGAAGCAA
CTGATCGCCTACTTCGTCCACAAACACCTGTTCTTGGAGAGCGAATTGCACATTCCCGACGAGCCACACGACGAC
CTCCTGGAGCAAGTCATGCTGTTATCTGTGGAAGAAAGGACTGACGAGACGATCAAGCAGCGTCAGAGGGAGCGG
CAGCGAATAATGCGGGAGCGGGCCTACAAGATCAAACTAAATCAGCTCTGGGCCGCACGCCCCGGACAGTCCCTG
AAAGAAGCCGCCATCGTGTGCAGCTTACCAGTATGCCAAGATTGCAAACGATTTGTCGCCGAGGTGAATGGCCAA
TTCGGGCTTGCCCTGCTACTACACCATCACTGCTTGGACCCTGGGTGCCCATCGTGTCCGCGATGA
Transcript >Hirsu2|8378
ATGGCCACAGAAAATCAGGAATCTACAGCCAGAGCTCAGTGGTGGGATAACGGCAACGTATGCATTCGGTGCCCT
CGGTGTGGCGAGCTACACCGTCACGGCTTCGATGGAAGATACACCGACGACAATCGGCGCGTGTCACACTGCGGC
CCAAACCGCGACGGCGGAGTCCGGGGTCAGCAATTGGAGTACAACATTCGATTTCCCGTCGGCTACGTCATCGAC
AAGAAGAACGTTCGATTCGTCGCCGGCGAGTATGAAGCTCTCGCATCTGCACGTAACATCGGGGTCTCGGACAAA
GAGAGGGTGGAGCGGCTGAGGCACCAGTTCAGAGAGCAAGTCCAACGAAGGCCAAAGTGGACCAGTGCGACCGAG
ATCGAGGAACTTTTCGAGGGTTTCACGGCAAAGACGATCGGCACAGCGGCGGCGAAGCTGGTGCTAGGCAATGTC
CAGTATGTTCGACGCTACATTGAGACGTCGGCCGATTCGAACATTTTCCTTCACGGAGTTGACTCGTGGTGCGAT
AACGACATGGAGACTGGAGACACGGACGTGAGAGAAGGCGCCGTTGGGACGCATGGGAAGACAGCTCTGCACATG
GCCGCGTGTGAAGCGTGTCCTGAGATGGTCGATCTTCTTCTCGCCAAGGGTGCCGATGTTAACGCGGCAGACCTC
AACGGCCGCACTCCTCTCATAGAGGCAGTTTCTTGGGGCCGCCTGCAGAACGTGGAGACTCTGCTGAGGTACGGG
GCCGACAAAACTTTGCCATGCATCGACCGGGAACGTTTGCTGCTTGCTGTCCACTGCGCGAGGACGCCGGAGGAG
AATGCACAGTCTCGCTGGCGCCCTATTTCTATACGTGGCTCCTCGAGCTTTGAGCCGGTTTCCAAGGAGAAGGCC
TACGCGAGAAACCGCGATCGAGAGCGGATTGTTCAGCTCCTTACCGATGGAGCAGAGGAACCCAGCGATCCTGAG
CTGGGCGGGTTTGATTTTCGGCCGGTCCATGTAGAGAGCGGATTGCTATCGTCAACGACCCAGTACGATCTGCAC
GACGAACCGATGACAGTGGCTCGTCTATATCGCGGTCAAGGACTGGCGGAAGTCTCTGCTGTGAGCGCCTGGTCT
CCCTCGCTAAGCGAAGCTATTCAAGTCGATGGCAGAGACTGGACGCCCCAAGTGTTTCAGTTATCTGCGTGTTTG
GGGCTCACAATGGAGCCCGACAAGCGTGACCAGGGAATTCCGGGTCAATTCAACGCAAGCCATGCCGAGAAGCAA
CTGATCGCCTACTTCGTCCACAAACACCTGTTCTTGGAGAGCGAATTGCACATTCCCGACGAGCCACACGACGAC
CTCCTGGAGCAAGTCATGCTGTTATCTGTGGAAGAAAGGACTGACGAGACGATCAAGCAGCGTCAGAGGGAGCGG
CAGCGAATAATGCGGGAGCGGGCCTACAAGATCAAACTAAATCAGCTCTGGGCCGCACGCCCCGGACAGTCCCTG
AAAGAAGCCGCCATCGTGTGCAGCTTACCAGTATGCCAAGATTGCAAACGATTTGTCGCCGAGGTGAATGGCCAA
TTCGGGCTTGCCCTGCTACTACACCATCACTGCTTGGACCCTGGGTGCCCATCGTGTCCGCGATGA
Gene >Hirsu2|8378
ATGGCCACAGAAAATCAGGAATCTACAGCCAGAGCTCAGTGGTGGGATAACGGCAACGTATGCATTCGGTGCCCT
CGGTGTGGCGAGCTACACCGTCACGGCTTCGATGGAAGATACACCGACGACAATCGGCGCGTGTCACACTGCGGC
CCAAACCGCGACGGCGGAGTCCGGGGTCAGCAATTGGAGTACAACATTCGATTTCCCGTCGGCTACGTCATCGAC
AAGAAGAACGTTCGATTCGTCGCCGGCGAGTATGAAGCTCTCGCATCTGCACGTAACATCGGGGTCTCGGACAAA
GAGAGGGTGGAGCGGCTGAGGCACCAGTTCAGAGAGCAAGTCCAACGAAGGCCAAAGTGGACCAGTGCGACCGAG
ATCGAGGAACTTTTCGAGGGTTTCACGGCAAAGACGATCGGCACAGCGGCGGCGAAGCTGGTGCTAGGCAATGTC
CAGTATGTTCGACGCTACATTGAGACGTCGGCCGATTCGAACATTTTCCTTCACGGAGTTGACTCGTGGTGCGAT
AACGACATGGAGACTGGAGACACGGACGTGAGAGAAGGCGCCGTTGGGACGCATGGGAAGACAGCTCTGCACATG
GCCGCGTGTGAAGCGTGTCCTGAGATGGTCGATCTTCTTCTCGCCAAGGGTGCCGATGTTAACGCGGCAGACCTC
AACGGCCGCACTCCTCTCATAGAGGCAGTTTCTTGGGGCCGCCTGCAGAACGTGGAGACTCTGCTGAGGTACGGG
GCCGACAAAACTTTGCCATGCATCGACCGGGAACGTTTGCTGCTTGCTGTCCACTGCGCGAGGACGCCGGAGGAG
AATGCACAGTCTCGCTGGCGCCCTATTTCTATACGTGGCTCCTCGAGCTTTGAGCCGGTTTCCAAGGAGAAGGCC
TACGCGAGAAACCGCGATCGAGAGCGGATTGTTCAGCTCCTTACCGATGGAGCAGAGGAACCCAGCGATCCTGAG
CTGGGCGGGTTTGATTTTCGGCCGGTCCATGTAGAGAGCGGATTGCTATCGTCAACGACCCAGTACGATCTGCAC
GACGAACCGATGACAGTGGCTCGTCTATATCGCGGTCAAGGACTGGCGGAAGTCTCTGCTGTGAGCGCCTGGTCT
CCCTCGCTAAGCGAAGCTATTCAAGTCGATGGCAGAGACTGGACGCCCCAAGTGTTTCAGTTATCTGCGTGTTTG
GGGCTCACAATGGAGCCCGACAAGCGTGACCAGGGAATTCCGGGTCAATTCAACGCAAGCCATGCCGAGAAGCAA
CTGATCGCCTACTTCGTCCACAAACACCTGTTCTTGGAGAGCGAATTGCACATTCCCGACGAGCCACACGACGAC
CTCCTGGAGCAAGTCATGCTGTTATCTGTGGAAGAAAGGACTGACGAGACGATCAAGCAGCGTCAGAGGGAGCGG
CAGCGAATAATGCGGGAGCGGGCCTACAAGATCAAACTAAATCAGCTCTGGGCCGCACGCCCCGGACAGTCCCTG
AAAGAAGCCGCCATCGTGTGCAGCTTACCAGTATGCCAAGATTGCAAACGATTTGTCGCCGAGGTGAATGGCCAA
TTCGGGCTTGCCCTGCTACTACACCATCACTGCTTGGACCCTGGGTGCCCATCGTGTCCGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail