Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8378
Gene name
LocationContig_542:8946..10587
Strand-
Gene length (bp)1641
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.1E-12 184 255
PF00023 Ank Ankyrin repeat 3.2E-06 193 224
PF13637 Ank_4 Ankyrin repeats (many copies) 1.6E-09 196 247
PF13606 Ank_3 Ankyrin repeat 5.2E-05 193 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7T2B9|MTPN_DANRE Myotrophin OS=Danio rerio GN=mtpn PE=3 SV=1 194 253 1.0E-07
sp|Q6P1S6|MTPN_XENTR Myotrophin OS=Xenopus tropicalis GN=mtpn PE=3 SV=1 178 255 1.0E-07
sp|Q7T0Q1|MTPN_XENLA Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 181 255 2.0E-07
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 194 255 3.0E-07
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 178 316 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7T2B9|MTPN_DANRE Myotrophin OS=Danio rerio GN=mtpn PE=3 SV=1 194 253 1.0E-07
sp|Q6P1S6|MTPN_XENTR Myotrophin OS=Xenopus tropicalis GN=mtpn PE=3 SV=1 178 255 1.0E-07
sp|Q7T0Q1|MTPN_XENLA Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 181 255 2.0E-07
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 194 255 3.0E-07
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 178 316 3.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 194 271 4.0E-07
sp|Q91955|MTPN_CHICK Myotrophin OS=Gallus gallus GN=MTPN PE=3 SV=1 194 255 6.0E-07
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 192 252 6.0E-07
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 194 252 8.0E-07
sp|Q3T0F7|MTPN_BOVIN Myotrophin OS=Bos taurus GN=MTPN PE=1 SV=3 194 255 1.0E-06
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 154 315 1.0E-06
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 194 252 1.0E-06
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 154 315 1.0E-06
sp|P62774|MTPN_MOUSE Myotrophin OS=Mus musculus GN=Mtpn PE=1 SV=2 194 255 1.0E-06
sp|P62775|MTPN_RAT Myotrophin OS=Rattus norvegicus GN=Mtpn PE=1 SV=2 194 255 1.0E-06
sp|Q863Z4|MTPN_CANLF Myotrophin OS=Canis lupus familiaris GN=MTPN PE=3 SV=3 194 255 1.0E-06
sp|P58546|MTPN_HUMAN Myotrophin OS=Homo sapiens GN=MTPN PE=1 SV=2 194 255 1.0E-06
sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 154 298 1.0E-06
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 193 252 2.0E-06
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 190 252 2.0E-06
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 130 260 2.0E-06
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 154 298 4.0E-06
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 190 252 4.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 194 261 5.0E-06
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 193 252 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6884 0.7079 0.1254 0.1448 0.276 0.086 0.1244 0.0971 0.0743 0.0092

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6631
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06334
Ophiocordyceps camponoti-rufipedis Ophun1|3525
Ophiocordyceps subramaniannii Hirsu2|4173
Ophiocordyceps subramaniannii Hirsu2|8378 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8378
MATENQESTARAQWWDNGNVCIRCPRCGELHRHGFDGRYTDDNRRVSHCGPNRDGGVRGQQLEYNIRFPVGYVID
KKNVRFVAGEYEALASARNIGVSDKERVERLRHQFREQVQRRPKWTSATEIEELFEGFTAKTIGTAAAKLVLGNV
QYVRRYIETSADSNIFLHGVDSWCDNDMETGDTDVREGAVGTHGKTALHMAACEACPEMVDLLLAKGADVNAADL
NGRTPLIEAVSWGRLQNVETLLRYGADKTLPCIDRERLLLAVHCARTPEENAQSRWRPISIRGSSSFEPVSKEKA
YARNRDRERIVQLLTDGAEEPSDPELGGFDFRPVHVESGLLSSTTQYDLHDEPMTVARLYRGQGLAEVSAVSAWS
PSLSEAIQVDGRDWTPQVFQLSACLGLTMEPDKRDQGIPGQFNASHAEKQLIAYFVHKHLFLESELHIPDEPHDD
LLEQVMLLSVEERTDETIKQRQRERQRIMRERAYKIKLNQLWAARPGQSLKEAAIVCSLPVCQDCKRFVAEVNGQ
FGLALLLHHHCLDPGCPSCPR*
Coding >Hirsu2|8378
ATGGCCACAGAAAATCAGGAATCTACAGCCAGAGCTCAGTGGTGGGATAACGGCAACGTATGCATTCGGTGCCCT
CGGTGTGGCGAGCTACACCGTCACGGCTTCGATGGAAGATACACCGACGACAATCGGCGCGTGTCACACTGCGGC
CCAAACCGCGACGGCGGAGTCCGGGGTCAGCAATTGGAGTACAACATTCGATTTCCCGTCGGCTACGTCATCGAC
AAGAAGAACGTTCGATTCGTCGCCGGCGAGTATGAAGCTCTCGCATCTGCACGTAACATCGGGGTCTCGGACAAA
GAGAGGGTGGAGCGGCTGAGGCACCAGTTCAGAGAGCAAGTCCAACGAAGGCCAAAGTGGACCAGTGCGACCGAG
ATCGAGGAACTTTTCGAGGGTTTCACGGCAAAGACGATCGGCACAGCGGCGGCGAAGCTGGTGCTAGGCAATGTC
CAGTATGTTCGACGCTACATTGAGACGTCGGCCGATTCGAACATTTTCCTTCACGGAGTTGACTCGTGGTGCGAT
AACGACATGGAGACTGGAGACACGGACGTGAGAGAAGGCGCCGTTGGGACGCATGGGAAGACAGCTCTGCACATG
GCCGCGTGTGAAGCGTGTCCTGAGATGGTCGATCTTCTTCTCGCCAAGGGTGCCGATGTTAACGCGGCAGACCTC
AACGGCCGCACTCCTCTCATAGAGGCAGTTTCTTGGGGCCGCCTGCAGAACGTGGAGACTCTGCTGAGGTACGGG
GCCGACAAAACTTTGCCATGCATCGACCGGGAACGTTTGCTGCTTGCTGTCCACTGCGCGAGGACGCCGGAGGAG
AATGCACAGTCTCGCTGGCGCCCTATTTCTATACGTGGCTCCTCGAGCTTTGAGCCGGTTTCCAAGGAGAAGGCC
TACGCGAGAAACCGCGATCGAGAGCGGATTGTTCAGCTCCTTACCGATGGAGCAGAGGAACCCAGCGATCCTGAG
CTGGGCGGGTTTGATTTTCGGCCGGTCCATGTAGAGAGCGGATTGCTATCGTCAACGACCCAGTACGATCTGCAC
GACGAACCGATGACAGTGGCTCGTCTATATCGCGGTCAAGGACTGGCGGAAGTCTCTGCTGTGAGCGCCTGGTCT
CCCTCGCTAAGCGAAGCTATTCAAGTCGATGGCAGAGACTGGACGCCCCAAGTGTTTCAGTTATCTGCGTGTTTG
GGGCTCACAATGGAGCCCGACAAGCGTGACCAGGGAATTCCGGGTCAATTCAACGCAAGCCATGCCGAGAAGCAA
CTGATCGCCTACTTCGTCCACAAACACCTGTTCTTGGAGAGCGAATTGCACATTCCCGACGAGCCACACGACGAC
CTCCTGGAGCAAGTCATGCTGTTATCTGTGGAAGAAAGGACTGACGAGACGATCAAGCAGCGTCAGAGGGAGCGG
CAGCGAATAATGCGGGAGCGGGCCTACAAGATCAAACTAAATCAGCTCTGGGCCGCACGCCCCGGACAGTCCCTG
AAAGAAGCCGCCATCGTGTGCAGCTTACCAGTATGCCAAGATTGCAAACGATTTGTCGCCGAGGTGAATGGCCAA
TTCGGGCTTGCCCTGCTACTACACCATCACTGCTTGGACCCTGGGTGCCCATCGTGTCCGCGATGA
Transcript >Hirsu2|8378
ATGGCCACAGAAAATCAGGAATCTACAGCCAGAGCTCAGTGGTGGGATAACGGCAACGTATGCATTCGGTGCCCT
CGGTGTGGCGAGCTACACCGTCACGGCTTCGATGGAAGATACACCGACGACAATCGGCGCGTGTCACACTGCGGC
CCAAACCGCGACGGCGGAGTCCGGGGTCAGCAATTGGAGTACAACATTCGATTTCCCGTCGGCTACGTCATCGAC
AAGAAGAACGTTCGATTCGTCGCCGGCGAGTATGAAGCTCTCGCATCTGCACGTAACATCGGGGTCTCGGACAAA
GAGAGGGTGGAGCGGCTGAGGCACCAGTTCAGAGAGCAAGTCCAACGAAGGCCAAAGTGGACCAGTGCGACCGAG
ATCGAGGAACTTTTCGAGGGTTTCACGGCAAAGACGATCGGCACAGCGGCGGCGAAGCTGGTGCTAGGCAATGTC
CAGTATGTTCGACGCTACATTGAGACGTCGGCCGATTCGAACATTTTCCTTCACGGAGTTGACTCGTGGTGCGAT
AACGACATGGAGACTGGAGACACGGACGTGAGAGAAGGCGCCGTTGGGACGCATGGGAAGACAGCTCTGCACATG
GCCGCGTGTGAAGCGTGTCCTGAGATGGTCGATCTTCTTCTCGCCAAGGGTGCCGATGTTAACGCGGCAGACCTC
AACGGCCGCACTCCTCTCATAGAGGCAGTTTCTTGGGGCCGCCTGCAGAACGTGGAGACTCTGCTGAGGTACGGG
GCCGACAAAACTTTGCCATGCATCGACCGGGAACGTTTGCTGCTTGCTGTCCACTGCGCGAGGACGCCGGAGGAG
AATGCACAGTCTCGCTGGCGCCCTATTTCTATACGTGGCTCCTCGAGCTTTGAGCCGGTTTCCAAGGAGAAGGCC
TACGCGAGAAACCGCGATCGAGAGCGGATTGTTCAGCTCCTTACCGATGGAGCAGAGGAACCCAGCGATCCTGAG
CTGGGCGGGTTTGATTTTCGGCCGGTCCATGTAGAGAGCGGATTGCTATCGTCAACGACCCAGTACGATCTGCAC
GACGAACCGATGACAGTGGCTCGTCTATATCGCGGTCAAGGACTGGCGGAAGTCTCTGCTGTGAGCGCCTGGTCT
CCCTCGCTAAGCGAAGCTATTCAAGTCGATGGCAGAGACTGGACGCCCCAAGTGTTTCAGTTATCTGCGTGTTTG
GGGCTCACAATGGAGCCCGACAAGCGTGACCAGGGAATTCCGGGTCAATTCAACGCAAGCCATGCCGAGAAGCAA
CTGATCGCCTACTTCGTCCACAAACACCTGTTCTTGGAGAGCGAATTGCACATTCCCGACGAGCCACACGACGAC
CTCCTGGAGCAAGTCATGCTGTTATCTGTGGAAGAAAGGACTGACGAGACGATCAAGCAGCGTCAGAGGGAGCGG
CAGCGAATAATGCGGGAGCGGGCCTACAAGATCAAACTAAATCAGCTCTGGGCCGCACGCCCCGGACAGTCCCTG
AAAGAAGCCGCCATCGTGTGCAGCTTACCAGTATGCCAAGATTGCAAACGATTTGTCGCCGAGGTGAATGGCCAA
TTCGGGCTTGCCCTGCTACTACACCATCACTGCTTGGACCCTGGGTGCCCATCGTGTCCGCGATGA
Gene >Hirsu2|8378
ATGGCCACAGAAAATCAGGAATCTACAGCCAGAGCTCAGTGGTGGGATAACGGCAACGTATGCATTCGGTGCCCT
CGGTGTGGCGAGCTACACCGTCACGGCTTCGATGGAAGATACACCGACGACAATCGGCGCGTGTCACACTGCGGC
CCAAACCGCGACGGCGGAGTCCGGGGTCAGCAATTGGAGTACAACATTCGATTTCCCGTCGGCTACGTCATCGAC
AAGAAGAACGTTCGATTCGTCGCCGGCGAGTATGAAGCTCTCGCATCTGCACGTAACATCGGGGTCTCGGACAAA
GAGAGGGTGGAGCGGCTGAGGCACCAGTTCAGAGAGCAAGTCCAACGAAGGCCAAAGTGGACCAGTGCGACCGAG
ATCGAGGAACTTTTCGAGGGTTTCACGGCAAAGACGATCGGCACAGCGGCGGCGAAGCTGGTGCTAGGCAATGTC
CAGTATGTTCGACGCTACATTGAGACGTCGGCCGATTCGAACATTTTCCTTCACGGAGTTGACTCGTGGTGCGAT
AACGACATGGAGACTGGAGACACGGACGTGAGAGAAGGCGCCGTTGGGACGCATGGGAAGACAGCTCTGCACATG
GCCGCGTGTGAAGCGTGTCCTGAGATGGTCGATCTTCTTCTCGCCAAGGGTGCCGATGTTAACGCGGCAGACCTC
AACGGCCGCACTCCTCTCATAGAGGCAGTTTCTTGGGGCCGCCTGCAGAACGTGGAGACTCTGCTGAGGTACGGG
GCCGACAAAACTTTGCCATGCATCGACCGGGAACGTTTGCTGCTTGCTGTCCACTGCGCGAGGACGCCGGAGGAG
AATGCACAGTCTCGCTGGCGCCCTATTTCTATACGTGGCTCCTCGAGCTTTGAGCCGGTTTCCAAGGAGAAGGCC
TACGCGAGAAACCGCGATCGAGAGCGGATTGTTCAGCTCCTTACCGATGGAGCAGAGGAACCCAGCGATCCTGAG
CTGGGCGGGTTTGATTTTCGGCCGGTCCATGTAGAGAGCGGATTGCTATCGTCAACGACCCAGTACGATCTGCAC
GACGAACCGATGACAGTGGCTCGTCTATATCGCGGTCAAGGACTGGCGGAAGTCTCTGCTGTGAGCGCCTGGTCT
CCCTCGCTAAGCGAAGCTATTCAAGTCGATGGCAGAGACTGGACGCCCCAAGTGTTTCAGTTATCTGCGTGTTTG
GGGCTCACAATGGAGCCCGACAAGCGTGACCAGGGAATTCCGGGTCAATTCAACGCAAGCCATGCCGAGAAGCAA
CTGATCGCCTACTTCGTCCACAAACACCTGTTCTTGGAGAGCGAATTGCACATTCCCGACGAGCCACACGACGAC
CTCCTGGAGCAAGTCATGCTGTTATCTGTGGAAGAAAGGACTGACGAGACGATCAAGCAGCGTCAGAGGGAGCGG
CAGCGAATAATGCGGGAGCGGGCCTACAAGATCAAACTAAATCAGCTCTGGGCCGCACGCCCCGGACAGTCCCTG
AAAGAAGCCGCCATCGTGTGCAGCTTACCAGTATGCCAAGATTGCAAACGATTTGTCGCCGAGGTGAATGGCCAA
TTCGGGCTTGCCCTGCTACTACACCATCACTGCTTGGACCCTGGGTGCCCATCGTGTCCGCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail