© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|8375 |
| Gene name | |
| Location | Contig_541:10666..11728 |
| Strand | - |
| Gene length (bp) | 1062 |
| Transcript length (bp) | 999 |
| Coding sequence length (bp) | 999 |
| Protein length (aa) | 333 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00107 | ADH_zinc_N | Zinc-binding dehydrogenase | 5.9E-25 | 155 | 279 |
| PF13602 | ADH_zinc_N_2 | Zinc-binding dehydrogenase | 1.9E-21 | 189 | 328 |
| PF08240 | ADH_N | Alcohol dehydrogenase GroES-like domain | 6.9E-09 | 30 | 90 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q53FA7|QORX_HUMAN | Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 | 8 | 331 | 3.0E-77 |
| sp|Q8JFV8|VAT1_DANRE | Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 | 9 | 330 | 2.0E-33 |
| sp|O94564|YGD6_SCHPO | Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 | 30 | 331 | 6.0E-32 |
| sp|O97764|QOR_BOVIN | Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 | 1 | 279 | 7.0E-30 |
| sp|Q28452|QOR_LAMGU | Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 | 1 | 328 | 1.0E-29 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q53FA7|QORX_HUMAN | Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 | 8 | 331 | 3.0E-77 |
| sp|Q8JFV8|VAT1_DANRE | Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 | 9 | 330 | 2.0E-33 |
| sp|O94564|YGD6_SCHPO | Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 | 30 | 331 | 6.0E-32 |
| sp|O97764|QOR_BOVIN | Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 | 1 | 279 | 7.0E-30 |
| sp|Q28452|QOR_LAMGU | Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 | 1 | 328 | 1.0E-29 |
| sp|Q0MVN8|QOR_PIG | Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 | 11 | 331 | 4.0E-29 |
| sp|A6QQF5|QORL2_BOVIN | Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 | 13 | 331 | 7.0E-29 |
| sp|P11415|QOR_CAVPO | Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 | 1 | 328 | 6.0E-28 |
| sp|B0BNC9|QORL2_RAT | Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 | 13 | 331 | 1.0E-27 |
| sp|Q08257|QOR_HUMAN | Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 | 1 | 331 | 2.0E-27 |
| sp|Q5R4S7|QOR_PONAB | Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 | 1 | 331 | 2.0E-27 |
| sp|Q6AYT0|QOR_RAT | Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 | 1 | 328 | 2.0E-27 |
| sp|Q3UNZ8|QORL2_MOUSE | Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 | 13 | 331 | 1.0E-26 |
| sp|P47199|QOR_MOUSE | Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 | 1 | 328 | 6.0E-26 |
| sp|Q99536|VAT1_HUMAN | Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 | 31 | 328 | 2.0E-25 |
| sp|Q8N4Q0|ZADH2_HUMAN | Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 | 13 | 328 | 3.0E-24 |
| sp|Q24K16|ZADH2_BOVIN | Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 | 13 | 331 | 5.0E-24 |
| sp|Q8BGC4|ZADH2_MOUSE | Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 | 13 | 331 | 2.0E-23 |
| sp|P38230|QOR_YEAST | Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 | 23 | 331 | 3.0E-23 |
| sp|Q59I44|CAA43_BURSP | 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 | 17 | 328 | 6.0E-23 |
| sp|O35017|YOGA_BACSU | Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 | 1 | 327 | 8.0E-23 |
| sp|P43903|QOR_PSEAE | Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 | 28 | 328 | 1.0E-21 |
| sp|P19333|VAT1_TORCA | Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 | 6 | 326 | 2.0E-21 |
| sp|P96202|PPSC_MYCTU | Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 | 8 | 331 | 1.0E-20 |
| sp|Q7TXL8|PPSC_MYCBO | Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 | 8 | 331 | 1.0E-20 |
| sp|Q3MIE4|VAT1_RAT | Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 | 31 | 328 | 1.0E-20 |
| sp|Q03132|ERYA2_SACER | Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 | 29 | 244 | 1.0E-20 |
| sp|P28304|QOR1_ECOLI | Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 | 34 | 249 | 2.0E-20 |
| sp|Q80TB8|VAT1L_MOUSE | Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 | 25 | 331 | 3.0E-20 |
| sp|Q9HCJ6|VAT1L_HUMAN | Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 | 25 | 331 | 4.0E-20 |
| sp|P40783|QOR_SALTY | Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 | 34 | 248 | 5.0E-20 |
| sp|Q62465|VAT1_MOUSE | Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 | 31 | 328 | 1.0E-19 |
| sp|A7RK30|QORL2_NEMVE | Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 | 28 | 328 | 1.0E-19 |
| sp|P42865|QOR_LEIAM | Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 | 30 | 331 | 2.0E-19 |
| sp|Q5HM44|ZDH1_STAEQ | Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 | 19 | 331 | 1.0E-18 |
| sp|Q869W9|PKS16_DICDI | Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 | 30 | 328 | 1.0E-18 |
| sp|Q869X2|PKS17_DICDI | Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 | 34 | 328 | 2.0E-18 |
| sp|Q02251|MCAS_MYCBO | Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 | 24 | 331 | 2.0E-18 |
| sp|Q558Y6|PKS14_DICDI | Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 | 31 | 243 | 3.0E-18 |
| sp|Q8CRJ7|ZDH1_STAES | Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 | 19 | 331 | 3.0E-18 |
| sp|P42328|ADH3_GEOSE | Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 | 21 | 332 | 9.0E-18 |
| sp|Q84V25|ENOXE_FRAAN | 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 | 14 | 329 | 2.0E-17 |
| sp|Q558W4|PKS15_DICDI | Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 | 34 | 243 | 2.0E-17 |
| sp|Q54D44|PKS42_DICDI | Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 | 34 | 328 | 2.0E-17 |
| sp|Q55CN6|PKS3_DICDI | Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 | 34 | 243 | 3.0E-17 |
| sp|B2HIL7|MSL7_MYCMM | Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 | 29 | 331 | 3.0E-17 |
| sp|Q9ZUC1|QORL_ARATH | Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 | 14 | 329 | 4.0E-17 |
| sp|Q54KU3|PKS25_DICDI | Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 | 34 | 243 | 6.0E-17 |
| sp|O74489|QOR_SCHPO | Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 | 18 | 328 | 7.0E-17 |
| sp|P34055|INC11_HYPAT | Protein indc11 OS=Hypocrea atroviridis GN=indc11 PE=2 SV=1 | 17 | 332 | 1.0E-16 |
| sp|Q54ED7|PKS40_DICDI | Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 | 34 | 243 | 2.0E-16 |
| sp|O23939|ENOX_FRAVE | 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 | 14 | 329 | 2.0E-16 |
| sp|Q4J781|ADH_SULAC | NAD-dependent alcohol dehydrogenase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=adh PE=3 SV=1 | 25 | 332 | 4.0E-16 |
| sp|K4BW79|ENOX_SOLLC | 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 | 11 | 329 | 5.0E-16 |
| sp|Q54ED6|PKS41_DICDI | Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 | 34 | 243 | 6.0E-16 |
| sp|A1KQG0|PHAS_MYCBP | Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 | 24 | 331 | 9.0E-16 |
| sp|P9WQE9|PHAS_MYCTU | Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 | 24 | 331 | 1.0E-15 |
| sp|P9WQE8|PHAS_MYCTO | Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 | 24 | 331 | 1.0E-15 |
| sp|A5U9F4|PHAS_MYCTA | Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 | 24 | 331 | 1.0E-15 |
| sp|Q7TVK8|PHAS_MYCBO | Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 | 24 | 331 | 1.0E-15 |
| sp|Q5HE19|ZDH1_STAAC | Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 | 1 | 331 | 1.0E-15 |
| sp|Q54TW0|PKS18_DICDI | Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 | 34 | 243 | 1.0E-15 |
| sp|Q54G30|PKS27_DICDI | Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 | 34 | 328 | 2.0E-15 |
| sp|Q6GEP3|ZDH1_STAAR | Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 | 1 | 331 | 2.0E-15 |
| sp|Q8NVD1|ZDH1_STAAW | Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 | 1 | 331 | 2.0E-15 |
| sp|Q6G7C8|ZDH1_STAAS | Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 | 1 | 331 | 2.0E-15 |
| sp|Q8H0M1|QORH_SPIOL | Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 | 1 | 236 | 3.0E-15 |
| sp|Q941I0|ENOXC_FRAAN | 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=2 | 14 | 329 | 3.0E-15 |
| sp|P12311|ADH1_GEOSE | Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 | 21 | 332 | 3.0E-15 |
| sp|P99173|ZDH1_STAAN | Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 | 1 | 331 | 4.0E-15 |
| sp|P63475|ZDH1_STAAM | Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 | 1 | 331 | 4.0E-15 |
| sp|Q54FI3|PKS37_DICDI | Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 | 28 | 244 | 5.0E-15 |
| sp|Q975C8|ACAR_SULTO | Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 | 21 | 328 | 7.0E-15 |
| sp|Q7TXK8|MSL7_MYCBO | Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 | 42 | 331 | 1.0E-14 |
| sp|P96285|PKS1_MYCTU | Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 | 42 | 331 | 1.0E-14 |
| sp|Q9SV68|QORH_ARATH | Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 | 19 | 328 | 1.0E-14 |
| sp|B0G170|PKS28_DICDI | Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 | 34 | 328 | 2.0E-14 |
| sp|Q55DM7|PKS2_DICDI | Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 | 34 | 328 | 3.0E-14 |
| sp|Q0VC50|RT4I1_BOVIN | Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 | 30 | 331 | 4.0E-14 |
| sp|Q55E72|PKS1_DICDI | Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 | 31 | 243 | 8.0E-14 |
| sp|P0DN30|RTAI1_ARTBC | Probable zinc-binding oxidoreductase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-2 PE=3 SV=1 | 22 | 331 | 9.0E-14 |
| sp|Q9UYX0|TDH_PYRAB | Probable L-threonine 3-dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tdh PE=3 SV=1 | 2 | 328 | 1.0E-13 |
| sp|Q54KU5|PKS24_DICDI | Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 | 34 | 245 | 3.0E-13 |
| sp|O95825|QORL1_HUMAN | Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 | 1 | 326 | 3.0E-13 |
| sp|Q8VDQ1|PTGR2_MOUSE | Prostaglandin reductase 2 OS=Mus musculus GN=Ptgr2 PE=1 SV=2 | 121 | 332 | 5.0E-13 |
| sp|Q54T36|PKS19_DICDI | Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 | 34 | 231 | 8.0E-13 |
| sp|O35045|YJMD_BACSU | Uncharacterized zinc-type alcohol dehydrogenase-like protein YjmD OS=Bacillus subtilis (strain 168) GN=yjmD PE=2 SV=1 | 1 | 274 | 9.0E-13 |
| sp|B0G138|PKS21_DICDI | Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 | 31 | 231 | 1.0E-12 |
| sp|Q54FQ1|PKS31_DICDI | Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 | 34 | 243 | 1.0E-12 |
| sp|P12785|FAS_RAT | Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 | 24 | 331 | 1.0E-12 |
| sp|Q54IX3|PKS26_DICDI | Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 | 34 | 225 | 1.0E-12 |
| sp|P19096|FAS_MOUSE | Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 | 63 | 331 | 1.0E-12 |
| sp|Q559A9|PKS13_DICDI | Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 | 34 | 330 | 3.0E-12 |
| sp|Q54FP8|PKS32_DICDI | Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 | 63 | 328 | 4.0E-12 |
| sp|Q8WWV3|RT4I1_HUMAN | Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 | 30 | 225 | 5.0E-12 |
| sp|Q9Z9U1|DHSO_BACHD | Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 | 17 | 277 | 6.0E-12 |
| sp|Q54FQ2|PKS30_DICDI | Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 | 63 | 231 | 9.0E-12 |
| sp|O94038|ADH2_CANAL | Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 | 21 | 328 | 1.0E-11 |
| sp|Q54FQ3|PKS29_DICDI | Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 | 60 | 246 | 1.0E-11 |
| sp|Q54FN7|PKS33_DICDI | Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 | 63 | 243 | 1.0E-11 |
| sp|Q921W4|QORL1_MOUSE | Quinone oxidoreductase-like protein 1 OS=Mus musculus GN=Cryzl1 PE=1 SV=1 | 1 | 220 | 1.0E-11 |
| sp|Q5R806|PTGR2_PONAB | Prostaglandin reductase 2 OS=Pongo abelii GN=PTGR2 PE=2 SV=2 | 121 | 332 | 1.0E-11 |
| sp|Q54FD2|PKS38_DICDI | Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 | 60 | 243 | 2.0E-11 |
| sp|P53912|YNN4_YEAST | Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 | 1 | 271 | 2.0E-11 |
| sp|P42327|ADH2_GEOSE | Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 | 21 | 328 | 2.0E-11 |
| sp|Q86JI5|PKS5_DICDI | Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 | 31 | 243 | 3.0E-11 |
| sp|Q924D0|RT4I1_MOUSE | Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 | 30 | 225 | 4.0E-11 |
| sp|B6YTJ5|TDH_THEON | Probable L-threonine 3-dehydrogenase OS=Thermococcus onnurineus (strain NA1) GN=tdh PE=3 SV=1 | 15 | 328 | 4.0E-11 |
| sp|Q54FN2|PKS34_DICDI | Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 | 34 | 243 | 6.0E-11 |
| sp|Q5BK81|PTGR2_RAT | Prostaglandin reductase 2 OS=Rattus norvegicus GN=Ptgr2 PE=2 SV=2 | 121 | 332 | 8.0E-11 |
| sp|Q8N8N7|PTGR2_HUMAN | Prostaglandin reductase 2 OS=Homo sapiens GN=PTGR2 PE=1 SV=1 | 121 | 332 | 1.0E-10 |
| sp|Q59A28|QORL1_BOVIN | Quinone oxidoreductase-like protein 1 OS=Bos taurus GN=CRYZL1 PE=2 SV=1 | 1 | 220 | 1.0E-10 |
| sp|P12276|FAS_CHICK | Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 | 63 | 331 | 1.0E-10 |
| sp|Q39172|P1_ARATH | NADP-dependent alkenal double bond reductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1 | 83 | 332 | 2.0E-10 |
| sp|A4YGN2|ACAR_METS5 | Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 | 1 | 330 | 2.0E-10 |
| sp|P00331|ADH2_YEAST | Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 | 12 | 332 | 2.0E-10 |
| sp|Q39173|P2_ARATH | NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 | 83 | 332 | 3.0E-10 |
| sp|Q32L99|PTGR2_BOVIN | Prostaglandin reductase 2 OS=Bos taurus GN=PTGR2 PE=2 SV=1 | 121 | 332 | 3.0E-10 |
| sp|Q54II4|RT4I1_DICDI | Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=rtn4ip1 PE=3 SV=1 | 1 | 165 | 3.0E-10 |
| sp|Q67N85|TDH_SYMTH | L-threonine 3-dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tdh PE=3 SV=1 | 21 | 328 | 4.0E-10 |
| sp|Q54FC8|PKS39_DICDI | Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 | 34 | 328 | 5.0E-10 |
| sp|Q9EQZ5|PTGR1_CAVPO | Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 | 129 | 330 | 5.0E-10 |
| sp|P54007|YL460_YEAST | Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 | 1 | 251 | 5.0E-10 |
| sp|Q7T3C7|RT4I1_DANRE | Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 | 6 | 331 | 5.0E-10 |
| sp|Q86AE3|PKS9_DICDI | Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 | 31 | 243 | 6.0E-10 |
| sp|P97584|PTGR1_RAT | Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 | 129 | 328 | 8.0E-10 |
| sp|Q54QD1|PKS23_DICDI | Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 | 34 | 243 | 8.0E-10 |
| sp|A7HEI5|TDH_ANADF | L-threonine 3-dehydrogenase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tdh PE=3 SV=1 | 1 | 278 | 1.0E-09 |
| sp|P49327|FAS_HUMAN | Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 | 63 | 331 | 1.0E-09 |
| sp|Q71SP7|FAS_BOVIN | Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 | 55 | 331 | 1.0E-09 |
| sp|Q9P7F4|YKK1_SCHPO | Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 | 1 | 210 | 2.0E-09 |
| sp|Q9Y7D0|LOVC_ASPTE | Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 | 11 | 222 | 2.0E-09 |
| sp|B0G100|PKS7_DICDI | Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 | 31 | 243 | 3.0E-09 |
| sp|Q96XE0|ADH_SULTO | NAD-dependent alcohol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=adh PE=1 SV=1 | 21 | 328 | 3.0E-09 |
| sp|Q5JI69|TDH_THEKO | Probable L-threonine 3-dehydrogenase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tdh PE=1 SV=1 | 15 | 328 | 4.0E-09 |
| sp|B4UMJ1|TDH_ANASK | L-threonine 3-dehydrogenase OS=Anaeromyxobacter sp. (strain K) GN=tdh PE=3 SV=1 | 14 | 278 | 5.0E-09 |
| sp|Q2IJN4|TDH_ANADE | L-threonine 3-dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tdh PE=3 SV=1 | 14 | 278 | 7.0E-09 |
| sp|Q91YR9|PTGR1_MOUSE | Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=1 SV=2 | 129 | 328 | 9.0E-09 |
| sp|B0G0Z9|PKS6_DICDI | Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 | 31 | 245 | 2.0E-08 |
| sp|P50381|ADH_SULSR | NAD-dependent alcohol dehydrogenase OS=Sulfolobus sp. (strain RC3) GN=adh PE=3 SV=1 | 19 | 328 | 3.0E-08 |
| sp|B0G101|PKS8_DICDI | Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 | 63 | 243 | 3.0E-08 |
| sp|Q9P6C8|ADH1_NEUCR | Alcohol dehydrogenase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adh-1 PE=3 SV=1 | 18 | 332 | 4.0E-08 |
| sp|Q9SLN8|DBR_TOBAC | 2-alkenal reductase (NADP(+)-dependent) OS=Nicotiana tabacum GN=DBR PE=1 SV=1 | 69 | 332 | 4.0E-08 |
| sp|Q8LCU7|MECR_ARATH | Probable trans-2-enoyl-CoA reductase, mitochondrial OS=Arabidopsis thaliana GN=At3g45770 PE=2 SV=1 | 2 | 196 | 5.0E-08 |
| sp|Q9C0Y6|YKM8_SCHPO | Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 | 60 | 332 | 5.0E-08 |
| sp|O00097|ADH1_PICST | Alcohol dehydrogenase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH1 PE=3 SV=1 | 21 | 332 | 7.0E-08 |
| sp|P54006|TOXD_COCCA | Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 | 33 | 238 | 1.0E-07 |
| sp|Q3IZ91|CCR_RHOS4 | Crotonyl-CoA reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ccr PE=3 SV=1 | 7 | 318 | 2.0E-07 |
| sp|P39462|ADH_SULSO | NAD-dependent alcohol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=adh PE=1 SV=1 | 25 | 328 | 2.0E-07 |
| sp|Q28719|PTGR1_RABIT | Prostaglandin reductase 1 OS=Oryctolagus cuniculus GN=PTGR1 PE=2 SV=1 | 129 | 326 | 3.0E-07 |
| sp|Q5AUY5|CIPB_EMENI | Zinc-binding alcohol dehydrogenase domain-containing protein cipB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cipB PE=1 SV=1 | 21 | 253 | 4.0E-07 |
| sp|O13309|ADH2_PICST | Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 | 21 | 332 | 6.0E-07 |
| sp|Q14914|PTGR1_HUMAN | Prostaglandin reductase 1 OS=Homo sapiens GN=PTGR1 PE=1 SV=2 | 129 | 328 | 1.0E-06 |
| sp|Q7A742|ADH_STAAN | Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1 | 91 | 328 | 2.0E-06 |
| sp|Q99W07|ADH_STAAM | Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1 | 91 | 328 | 2.0E-06 |
| sp|Q8NXU1|ADH_STAAW | Alcohol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=adh PE=3 SV=1 | 91 | 328 | 2.0E-06 |
| sp|Q6GBM4|ADH_STAAS | Alcohol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=adh PE=3 SV=1 | 91 | 328 | 2.0E-06 |
| sp|Q6GJ63|ADH_STAAR | Alcohol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=adh PE=3 SV=1 | 91 | 328 | 2.0E-06 |
| sp|Q5HI63|ADH_STAAC | Alcohol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=adh PE=3 SV=1 | 91 | 328 | 2.0E-06 |
| sp|Q2YSX0|ADH_STAAB | Alcohol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=adh PE=3 SV=1 | 91 | 328 | 2.0E-06 |
| sp|Q2G0G1|ADH_STAA8 | Alcohol dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=adh PE=3 SV=1 | 91 | 328 | 2.0E-06 |
| sp|Q2FJ31|ADH_STAA3 | Alcohol dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=adh PE=3 SV=1 | 91 | 328 | 2.0E-06 |
| sp|P76113|CURA_ECOLI | NADPH-dependent curcumin reductase OS=Escherichia coli (strain K12) GN=curA PE=1 SV=3 | 26 | 268 | 4.0E-06 |
| sp|Q65JE7|TDH_BACLD | L-threonine 3-dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tdh PE=3 SV=1 | 89 | 328 | 5.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 29 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|8375 MKAIDIKDGKGERDALFVNAETPRPTAGAGQALVKVKAFGINRMDIVQRRGLYPVPPQAPKTLGVEFSGVVEALG AGVDGGAFRVGDEVFGLAYGGAYAEYVAVSAKMLIHKPAGLSWEQAAGLPEAWITATQALHLVLGFARGKSILWH AGASGVSIAGIQLSRLAGASAVYATAGSDEKCRFVTESLGASAAFNYKTRDWAAALREATGGQGVDYIVDFVGGS YFQQNLDAAARDCRIVLLGTMGGSKVPDADISQILYKRIRIEGSTLRSRDEAYQGQLRDKLETYLPDFEAGRLQI KLDKVIPWEQIQEAHAYMEEAKNTGKIVCTIS* |
| Coding | >Hirsu2|8375 ATGAAGGCGATCGACATCAAGGACGGCAAGGGTGAGCGGGACGCGCTCTTCGTCAACGCCGAGACGCCGCGGCCG ACGGCGGGCGCGGGCCAGGCGCTCGTCAAGGTCAAGGCCTTCGGCATCAACCGCATGGACATCGTCCAGCGGCGC GGCCTCTACCCGGTGCCGCCGCAGGCGCCCAAGACGCTGGGCGTCGAGTTCAGCGGCGTCGTTGAGGCGCTGGGC GCGGGCGTCGACGGCGGCGCCTTTCGCGTCGGCGACGAAGTCTTCGGCCTGGCCTATGGCGGCGCCTACGCCGAG TACGTGGCCGTCAGCGCCAAGATGCTCATCCACAAGCCGGCCGGCCTGAGCTGGGAGCAGGCGGCCGGCCTGCCC GAGGCGTGGATCACGGCGACGCAGGCGCTGCACCTGGTCCTCGGCTTCGCGCGCGGCAAGTCGATCCTCTGGCAC GCCGGCGCCTCGGGCGTCTCCATCGCCGGCATCCAGCTGTCGCGTCTGGCCGGCGCCTCGGCCGTCTACGCCACG GCCGGCTCCGACGAAAAGTGCCGCTTCGTGACCGAGAGCCTCGGCGCGAGCGCCGCCTTCAACTACAAGACGCGC GACTGGGCCGCCGCCTTGCGCGAGGCCACCGGCGGGCAGGGCGTCGACTACATTGTCGACTTTGTGGGCGGCAGC TACTTCCAGCAGAACCTCGACGCCGCCGCCCGCGATTGCCGCATCGTCCTGCTCGGCACCATGGGCGGCTCCAAG GTCCCCGACGCCGACATCTCCCAGATCCTCTATAAGCGCATCCGCATCGAGGGCAGCACCCTGCGCAGCCGCGAC GAGGCCTACCAGGGCCAGCTGCGCGACAAGCTCGAGACGTATCTGCCCGACTTCGAGGCCGGGCGCCTCCAGATA AAGCTGGACAAGGTAATCCCGTGGGAGCAGATCCAGGAGGCCCACGCGTACATGGAAGAGGCCAAGAACACGGGC AAGATTGTGTGCACCATTTCTTAA |
| Transcript | >Hirsu2|8375 ATGAAGGCGATCGACATCAAGGACGGCAAGGGTGAGCGGGACGCGCTCTTCGTCAACGCCGAGACGCCGCGGCCG ACGGCGGGCGCGGGCCAGGCGCTCGTCAAGGTCAAGGCCTTCGGCATCAACCGCATGGACATCGTCCAGCGGCGC GGCCTCTACCCGGTGCCGCCGCAGGCGCCCAAGACGCTGGGCGTCGAGTTCAGCGGCGTCGTTGAGGCGCTGGGC GCGGGCGTCGACGGCGGCGCCTTTCGCGTCGGCGACGAAGTCTTCGGCCTGGCCTATGGCGGCGCCTACGCCGAG TACGTGGCCGTCAGCGCCAAGATGCTCATCCACAAGCCGGCCGGCCTGAGCTGGGAGCAGGCGGCCGGCCTGCCC GAGGCGTGGATCACGGCGACGCAGGCGCTGCACCTGGTCCTCGGCTTCGCGCGCGGCAAGTCGATCCTCTGGCAC GCCGGCGCCTCGGGCGTCTCCATCGCCGGCATCCAGCTGTCGCGTCTGGCCGGCGCCTCGGCCGTCTACGCCACG GCCGGCTCCGACGAAAAGTGCCGCTTCGTGACCGAGAGCCTCGGCGCGAGCGCCGCCTTCAACTACAAGACGCGC GACTGGGCCGCCGCCTTGCGCGAGGCCACCGGCGGGCAGGGCGTCGACTACATTGTCGACTTTGTGGGCGGCAGC TACTTCCAGCAGAACCTCGACGCCGCCGCCCGCGATTGCCGCATCGTCCTGCTCGGCACCATGGGCGGCTCCAAG GTCCCCGACGCCGACATCTCCCAGATCCTCTATAAGCGCATCCGCATCGAGGGCAGCACCCTGCGCAGCCGCGAC GAGGCCTACCAGGGCCAGCTGCGCGACAAGCTCGAGACGTATCTGCCCGACTTCGAGGCCGGGCGCCTCCAGATA AAGCTGGACAAGGTAATCCCGTGGGAGCAGATCCAGGAGGCCCACGCGTACATGGAAGAGGCCAAGAACACGGGC AAGATTGTGTGCACCATTTCTTAA |
| Gene | >Hirsu2|8375 ATGAAGGCGATCGGTATGGCTCCCCTGCCCTCCTCGCCCGGAGGCAAGATGCGGCGGCGGAGCTGACGGGCCAAA GACATCAAGGACGGCAAGGGTGAGCGGGACGCGCTCTTCGTCAACGCCGAGACGCCGCGGCCGACGGCGGGCGCG GGCCAGGCGCTCGTCAAGGTCAAGGCCTTCGGCATCAACCGCATGGACATCGTCCAGCGGCGCGGCCTCTACCCG GTGCCGCCGCAGGCGCCCAAGACGCTGGGCGTCGAGTTCAGCGGCGTCGTTGAGGCGCTGGGCGCGGGCGTCGAC GGCGGCGCCTTTCGCGTCGGCGACGAAGTCTTCGGCCTGGCCTATGGCGGCGCCTACGCCGAGTACGTGGCCGTC AGCGCCAAGATGCTCATCCACAAGCCGGCCGGCCTGAGCTGGGAGCAGGCGGCCGGCCTGCCCGAGGCGTGGATC ACGGCGACGCAGGCGCTGCACCTGGTCCTCGGCTTCGCGCGCGGCAAGTCGATCCTCTGGCACGCCGGCGCCTCG GGCGTCTCCATCGCCGGCATCCAGCTGTCGCGTCTGGCCGGCGCCTCGGCCGTCTACGCCACGGCCGGCTCCGAC GAAAAGTGCCGCTTCGTGACCGAGAGCCTCGGCGCGAGCGCCGCCTTCAACTACAAGACGCGCGACTGGGCCGCC GCCTTGCGCGAGGCCACCGGCGGGCAGGGCGTCGACTACATTGTCGACTTTGTGGGCGGCAGCTACTTCCAGCAG AACCTCGACGCCGCCGCCCGCGATTGCCGCATCGTCCTGCTCGGCACCATGGGCGGCTCCAAGGTCCCCGACGCC GACATCTCCCAGATCCTCTATAAGCGCATCCGCATCGAGGGCAGCACCCTGCGCAGCCGCGACGAGGCCTACCAG GGCCAGCTGCGCGACAAGCTCGAGACGTATCTGCCCGACTTCGAGGCCGGGCGCCTCCAGATAAAGCTGGACAAG GTAATCCCGTGGGAGCAGATCCAGGAGGCCCACGCGTACATGGAAGAGGCCAAGAACACGGGCAAGATTGTGTGC ACCATTTCTTAA |