Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8371
Gene name
LocationContig_540:14089..15450
Strand-
Gene length (bp)1361
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 6.2E-10 97 362

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8371
MVRSAIVWLALAAAATAGNKNCKEIGTHIKVEARNGVFALRVPQTEVEVTNFILKLTVQNGNYTDSILRDYKTVL
QDYHLSGIYCEPDYGKTRGLQILTHGIGFDRSYWDHPWRNYQNSYVQAALDDGWSTLTWDRLGIGASAHAHPLTD
LQLFTEIKALKQFTRYAKSADLAGGKYKDKKIVHVGHSFGAALTMGMTSESPELSDGIILTGFSQVPDFVSEFAL
GGNFVSAQDVPNLRPHYKHGYLAPKSSIGVHQNFFAPDTFEPELLKFVTERGQPAAMGELLTIGSLPKQSNFNGP
VMIVTGDKDIPFCGGNCHNTKAINGSAADLLELSRNNFKAASVFNTTIIKHAGHGLNLQHGALVTYRTILDFIGD
NVKA*
Coding >Hirsu2|8371
ATGGTTCGATCGGCCATCGTCTGGCTGGCCCTGGCTGCCGCCGCCACCGCGGGCAACAAGAACTGCAAGGAAATC
GGGACCCACATCAAGGTGGAGGCTCGGAACGGCGTCTTCGCCTTGAGGGTGCCCCAGACGGAGGTGGAGGTGACC
AACTTCATCCTGAAGCTCACGGTGCAGAACGGCAACTATACAGACAGCATCCTCAGAGACTATAAGACGGTCCTC
CAGGACTATCACCTCTCCGGCATCTACTGCGAGCCCGACTACGGCAAGACGCGGGGCCTTCAGATCCTCACGCAC
GGCATCGGCTTCGACCGCTCCTACTGGGACCACCCGTGGCGGAACTACCAGAACAGCTACGTGCAGGCGGCTCTG
GACGATGGCTGGTCGACCCTGACCTGGGACCGGCTCGGCATCGGCGCCTCGGCGCACGCCCATCCCCTGACCGAT
CTGCAGCTCTTCACCGAGATCAAGGCGCTCAAGCAGTTCACCCGCTATGCCAAGTCGGCTGACCTGGCGGGCGGC
AAGTACAAGGACAAGAAGATTGTCCACGTCGGCCACTCCTTCGGCGCCGCCCTGACCATGGGCATGACCAGCGAG
TCGCCCGAGCTGAGCGACGGCATCATCCTCACCGGCTTCTCCCAGGTGCCCGACTTCGTCTCCGAGTTCGCCCTC
GGCGGCAACTTCGTCTCCGCCCAGGACGTCCCCAACCTCCGGCCTCACTACAAGCACGGATATCTGGCCCCCAAG
TCCAGCATCGGCGTCCACCAGAACTTCTTTGCCCCGGACACCTTCGAGCCGGAACTCCTCAAGTTCGTGACGGAA
AGAGGCCAGCCTGCCGCAATGGGCGAGCTCCTCACCATCGGCTCCCTCCCCAAGCAGTCCAATTTCAACGGGCCC
GTGATGATAGTCACTGGAGACAAGGATATCCCCTTCTGCGGCGGCAACTGCCATAACACAAAGGCCATCAACGGC
AGCGCCGCCGACCTTCTCGAACTGTCAAGGAACAACTTCAAGGCCGCCTCCGTCTTCAACACGACCATTATCAAA
CACGCCGGCCACGGACTCAACCTGCAGCACGGCGCGCTCGTGACCTACAGGACGATACTCGACTTCATCGGCGAC
AACGTCAAAGCTTGA
Transcript >Hirsu2|8371
ATGGTTCGATCGGCCATCGTCTGGCTGGCCCTGGCTGCCGCCGCCACCGCGGGCAACAAGAACTGCAAGGAAATC
GGGACCCACATCAAGGTGGAGGCTCGGAACGGCGTCTTCGCCTTGAGGGTGCCCCAGACGGAGGTGGAGGTGACC
AACTTCATCCTGAAGCTCACGGTGCAGAACGGCAACTATACAGACAGCATCCTCAGAGACTATAAGACGGTCCTC
CAGGACTATCACCTCTCCGGCATCTACTGCGAGCCCGACTACGGCAAGACGCGGGGCCTTCAGATCCTCACGCAC
GGCATCGGCTTCGACCGCTCCTACTGGGACCACCCGTGGCGGAACTACCAGAACAGCTACGTGCAGGCGGCTCTG
GACGATGGCTGGTCGACCCTGACCTGGGACCGGCTCGGCATCGGCGCCTCGGCGCACGCCCATCCCCTGACCGAT
CTGCAGCTCTTCACCGAGATCAAGGCGCTCAAGCAGTTCACCCGCTATGCCAAGTCGGCTGACCTGGCGGGCGGC
AAGTACAAGGACAAGAAGATTGTCCACGTCGGCCACTCCTTCGGCGCCGCCCTGACCATGGGCATGACCAGCGAG
TCGCCCGAGCTGAGCGACGGCATCATCCTCACCGGCTTCTCCCAGGTGCCCGACTTCGTCTCCGAGTTCGCCCTC
GGCGGCAACTTCGTCTCCGCCCAGGACGTCCCCAACCTCCGGCCTCACTACAAGCACGGATATCTGGCCCCCAAG
TCCAGCATCGGCGTCCACCAGAACTTCTTTGCCCCGGACACCTTCGAGCCGGAACTCCTCAAGTTCGTGACGGAA
AGAGGCCAGCCTGCCGCAATGGGCGAGCTCCTCACCATCGGCTCCCTCCCCAAGCAGTCCAATTTCAACGGGCCC
GTGATGATAGTCACTGGAGACAAGGATATCCCCTTCTGCGGCGGCAACTGCCATAACACAAAGGCCATCAACGGC
AGCGCCGCCGACCTTCTCGAACTGTCAAGGAACAACTTCAAGGCCGCCTCCGTCTTCAACACGACCATTATCAAA
CACGCCGGCCACGGACTCAACCTGCAGCACGGCGCGCTCGTGACCTACAGGACGATACTCGACTTCATCGGCGAC
AACGTCAAAGCTTGA
Gene >Hirsu2|8371
ATGGTTCGATCGGCCATCGTCTGGCTGGCCCTGGCTGCCGCCGCCACCGCGGGCAACAAGAACTGCAAGGAAATC
GGGACCCACATCAAGGTGGAGGCTCGGAACGGCGTCTTCGCCTTGAGGGTGCCCCAGACGGAGGTGGAGGTGACC
AACTTCATCCTGAAGCTCACGGTGCAGAACGGCAACTATACAGACAGCATCCTCAGAGACGTAAGTCGCGAGCAT
CGATCCCAGCGGGACGAGGAGGAGGAGGGGAGGGAGGCCCAAAGGGCTCGCTGACGGCCCGGCTGCGCAGTATAA
GACGGTCCTCCAGGACTATCACCTCTCCGGCATCTACTGCGAGCCCGACTACGGCAAGACGCGGGGCCTTCAGAT
CCTCACGCACGGCATCGGCTTCGACCGCTCCTACTGGGACCACCCGTGGCGGAACTACCAGAACAGCTACGTGCA
GGCGGCTCTGGACGATGGCTGGTCGACCCTGACCTGGGACCGGCTCGGCATCGGCGCCTCGGCGCACGCCCATCC
CCTGACCGATCTGCAGCTCTTCACCGAGATCAAGGCGCTCAAGCAGTTCACCCGCTATGCCAAGTCGGCTGACCT
GGCGGGCGGCAAGTACAAGGACAAGAAGATTGTCCACGTCGGCCACTCCTTCGGCGCCGCCCTGACCATGGGCAT
GACCAGCGAGTCGCCCGAGCTGAGCGACGGCATCATCCTCACCGGCTTCTCCCAGGTGCCCGACTTCGTCTCCGA
GTTCGCCCTCGGCGGCAACTTCGTCTCCGCCCAGGACGTCCCCAACCTCCGGCCTCACTACAAGCACGGATATCT
GGCCCCCAAGTCCAGCATCGGCGTCCACCAGAACTTCTTTGCCCCGGACACCTTCGAGCCGGAACTCCTCAAGTT
CGTGACGGAAAGAGGCCAGCCTGCCGCAATGGGCGAGCTCCTCACCATCGGCTCCCTCCCCAAGCAGTCCAATTT
CAACGGGCCCGTGATGATAGTCACTGGAGGTATGAGCAAGCCCCCCCCCTTTCTCTTATATCTCTGCCCAGCCCC
TTCACCCCTCGACCCCGCGGATCCCGATGAGGAACATATCGCCAGGGCCGTGGGTGTTGATGAGTCGACTGACCA
ATCCCGATCCTGCAGACAAGGATATCCCCTTCTGCGGCGGCAACTGCCATAACACAAAGGCCATCAACGGCAGCG
CCGCCGACCTTCTCGAACTGTCAAGGAACAACTTCAAGGCCGCCTCCGTCTTCAACACGACCATTATCAAACACG
CCGGCCACGGACTCAACCTGCAGCACGGCGCGCTCGTGACCTACAGGACGATACTCGACTTCATCGGCGACAACG
TCAAAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail