Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8367
Gene name
LocationContig_540:1830..3258
Strand-
Gene length (bp)1428
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01062 Bestrophin Bestrophin, RFP-TM, chloride channel 1.2E-35 72 391

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P72926|Y1024_SYNY3 UPF0187 protein sll1024 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1024 PE=3 SV=2 74 398 6.0E-32
sp|Q8YSU5|Y2987_NOSS1 UPF0187 protein alr2987 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2987 PE=3 SV=1 66 403 2.0E-28
sp|Q8ZPI0|YNEE_SALTY UPF0187 protein YneE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yneE PE=3 SV=2 74 397 2.0E-27
sp|Q8Z706|YNEE_SALTI UPF0187 protein YneE OS=Salmonella typhi GN=yneE PE=3 SV=2 74 397 2.0E-27
sp|Q8XAZ3|YNEE_ECO57 UPF0187 protein YneE OS=Escherichia coli O157:H7 GN=yneE PE=3 SV=2 79 397 7.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P72926|Y1024_SYNY3 UPF0187 protein sll1024 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1024 PE=3 SV=2 74 398 6.0E-32
sp|Q8YSU5|Y2987_NOSS1 UPF0187 protein alr2987 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2987 PE=3 SV=1 66 403 2.0E-28
sp|Q8ZPI0|YNEE_SALTY UPF0187 protein YneE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yneE PE=3 SV=2 74 397 2.0E-27
sp|Q8Z706|YNEE_SALTI UPF0187 protein YneE OS=Salmonella typhi GN=yneE PE=3 SV=2 74 397 2.0E-27
sp|Q8XAZ3|YNEE_ECO57 UPF0187 protein YneE OS=Escherichia coli O157:H7 GN=yneE PE=3 SV=2 79 397 7.0E-24
sp|P76146|YNEE_ECOLI UPF0187 protein YneE OS=Escherichia coli (strain K12) GN=yneE PE=3 SV=2 79 397 7.0E-24
sp|Q98E66|Y4386_RHILO UPF0187 protein mll4386 OS=Rhizobium loti (strain MAFF303099) GN=mll4386 PE=3 SV=1 74 391 2.0E-17
sp|Q8XTY1|Y3414_RALSO UPF0187 protein RSc3414 OS=Ralstonia solanacearum (strain GMI1000) GN=RSc3414 PE=3 SV=1 297 393 6.0E-09
sp|Q8XTY1|Y3414_RALSO UPF0187 protein RSc3414 OS=Ralstonia solanacearum (strain GMI1000) GN=RSc3414 PE=3 SV=1 66 199 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 86 103 17
2 108 130 22
3 316 338 22
4 348 370 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8367
MADGGDVIGELPQGSHQEARRVRSIEIPPLDKVCSPQSPVVPVAPQSFHRRGSFDLDDYFTGPRDIAKHSKWPLI
LQLHGSIMPKLILPLLLISIWATAITVISAKVHYLGVQSVLITVTGFVVSLSLSFRSSTAYERYTEGRKYWATLV
QASQILGRVFWIHATDRGSEFDAREVLLQKLSSMNLLVAFSLALKHSLRFEPYTAYPDLQNLIGHLDTFAKSATE
AQGSISTAHKKKFFRGVGEYLGVSFAASNPRKAIKKASRPLGNLPLEILSHLAVTIDTLVANEQLRVPIHQTMAF
NALQSLNDVMTGTERVLCTPLPIAYTIAISQSTYLYIALLPFQLIPLLQWTAIPATIAASWIILGLLFIGQEVEN
PFGQDVNDLPLDSYCEQIAADLDIIASFDMRESRKFLTSSNNLPLYPVSTAPVSVWMQRSEEKLREAIKQKPVKT
FEWRRWGTKHCSSSAATSVAGDHNV*
Coding >Hirsu2|8367
ATGGCAGACGGCGGCGATGTCATTGGCGAGCTGCCCCAAGGCAGCCACCAAGAAGCCAGGCGCGTGCGAAGCATC
GAGATACCACCGCTGGACAAAGTCTGTTCTCCGCAGTCGCCCGTCGTCCCTGTCGCTCCTCAATCGTTCCATCGA
AGGGGCTCTTTCGATCTCGACGATTACTTCACCGGACCCCGAGACATCGCAAAGCACTCGAAATGGCCACTGATC
CTACAGCTCCACGGCAGCATCATGCCAAAGCTTATTCTGCCGTTGCTGTTGATTAGCATCTGGGCAACTGCCATC
ACCGTCATCTCGGCCAAGGTCCACTATCTCGGCGTCCAGTCTGTCCTCATCACCGTGACAGGCTTTGTCGTCTCC
TTGTCTCTCTCCTTCCGATCTTCGACCGCATACGAGCGCTACACCGAGGGGAGAAAGTACTGGGCAACTCTCGTC
CAGGCGTCGCAGATCCTGGGACGTGTCTTCTGGATCCACGCCACGGATCGAGGCAGCGAGTTCGACGCCCGCGAG
GTTCTCCTGCAGAAGCTGAGTTCGATGAACCTGCTTGTCGCCTTCTCGTTGGCCCTCAAACACAGCCTACGATTC
GAGCCCTACACGGCCTACCCAGACCTGCAAAACCTCATCGGCCACCTCGACACGTTTGCCAAATCAGCGACCGAG
GCGCAGGGATCGATTTCAACCGCGCATAAGAAGAAGTTCTTCCGCGGTGTGGGCGAGTACCTCGGCGTCTCCTTC
GCCGCAAGCAACCCTCGAAAGGCGATCAAGAAAGCCTCGCGTCCCTTGGGCAACCTGCCCCTGGAGATTCTGAGC
CACCTGGCCGTGACAATTGACACGCTGGTGGCGAATGAACAGCTTCGAGTTCCCATACACCAGACCATGGCCTTC
AATGCCCTGCAGTCGCTCAACGACGTCATGACGGGCACCGAGCGCGTCCTCTGCACGCCCCTGCCCATCGCCTAC
ACCATCGCCATTTCGCAGTCGACCTATCTGTACATCGCCCTGCTGCCGTTCCAGCTGATTCCGCTGCTGCAGTGG
ACCGCGATCCCGGCGACCATCGCAGCTAGCTGGATCATCCTCGGCCTGCTCTTCATCGGGCAGGAAGTCGAAAAC
CCCTTTGGGCAGGATGTCAACGACCTGCCGCTCGACAGCTACTGCGAGCAGATTGCCGCAGACCTGGACATCATC
GCCTCCTTCGACATGCGCGAATCTAGAAAGTTCCTAACGAGTAGCAACAACTTGCCGCTGTACCCCGTCAGCACG
GCACCTGTCAGTGTCTGGATGCAGCGCAGCGAAGAGAAGCTACGCGAGGCCATCAAGCAGAAGCCCGTCAAGACG
TTCGAGTGGCGACGATGGGGAACCAAACATTGCAGTTCCAGTGCGGCAACCAGCGTCGCAGGCGATCACAACGTC
TAA
Transcript >Hirsu2|8367
ATGGCAGACGGCGGCGATGTCATTGGCGAGCTGCCCCAAGGCAGCCACCAAGAAGCCAGGCGCGTGCGAAGCATC
GAGATACCACCGCTGGACAAAGTCTGTTCTCCGCAGTCGCCCGTCGTCCCTGTCGCTCCTCAATCGTTCCATCGA
AGGGGCTCTTTCGATCTCGACGATTACTTCACCGGACCCCGAGACATCGCAAAGCACTCGAAATGGCCACTGATC
CTACAGCTCCACGGCAGCATCATGCCAAAGCTTATTCTGCCGTTGCTGTTGATTAGCATCTGGGCAACTGCCATC
ACCGTCATCTCGGCCAAGGTCCACTATCTCGGCGTCCAGTCTGTCCTCATCACCGTGACAGGCTTTGTCGTCTCC
TTGTCTCTCTCCTTCCGATCTTCGACCGCATACGAGCGCTACACCGAGGGGAGAAAGTACTGGGCAACTCTCGTC
CAGGCGTCGCAGATCCTGGGACGTGTCTTCTGGATCCACGCCACGGATCGAGGCAGCGAGTTCGACGCCCGCGAG
GTTCTCCTGCAGAAGCTGAGTTCGATGAACCTGCTTGTCGCCTTCTCGTTGGCCCTCAAACACAGCCTACGATTC
GAGCCCTACACGGCCTACCCAGACCTGCAAAACCTCATCGGCCACCTCGACACGTTTGCCAAATCAGCGACCGAG
GCGCAGGGATCGATTTCAACCGCGCATAAGAAGAAGTTCTTCCGCGGTGTGGGCGAGTACCTCGGCGTCTCCTTC
GCCGCAAGCAACCCTCGAAAGGCGATCAAGAAAGCCTCGCGTCCCTTGGGCAACCTGCCCCTGGAGATTCTGAGC
CACCTGGCCGTGACAATTGACACGCTGGTGGCGAATGAACAGCTTCGAGTTCCCATACACCAGACCATGGCCTTC
AATGCCCTGCAGTCGCTCAACGACGTCATGACGGGCACCGAGCGCGTCCTCTGCACGCCCCTGCCCATCGCCTAC
ACCATCGCCATTTCGCAGTCGACCTATCTGTACATCGCCCTGCTGCCGTTCCAGCTGATTCCGCTGCTGCAGTGG
ACCGCGATCCCGGCGACCATCGCAGCTAGCTGGATCATCCTCGGCCTGCTCTTCATCGGGCAGGAAGTCGAAAAC
CCCTTTGGGCAGGATGTCAACGACCTGCCGCTCGACAGCTACTGCGAGCAGATTGCCGCAGACCTGGACATCATC
GCCTCCTTCGACATGCGCGAATCTAGAAAGTTCCTAACGAGTAGCAACAACTTGCCGCTGTACCCCGTCAGCACG
GCACCTGTCAGTGTCTGGATGCAGCGCAGCGAAGAGAAGCTACGCGAGGCCATCAAGCAGAAGCCCGTCAAGACG
TTCGAGTGGCGACGATGGGGAACCAAACATTGCAGTTCCAGTGCGGCAACCAGCGTCGCAGGCGATCACAACGTC
TAA
Gene >Hirsu2|8367
ATGGCAGACGGCGGCGATGTCATTGGCGAGCTGCCCCAAGGCAGCCACCAAGAAGCCAGGCGCGTGCGAAGCATC
GAGATACCACCGCTGGACAAAGTCTGTTCTCCGCAGTCGCCCGTCGTCCCTGTCGCTCCTCAATCGTTCCATCGA
AGGGGCTCTTTCGATCTCGACGATTACTTCACCGGACCCCGAGACATCGCAAAGCACTCGAAATGGCCACTGATC
CTACAGCTCCACGGCAGCATCATGCCAAAGCTTATTCTGCCGTTGCTGTTGATTAGCATCTGGGCAACTGCCATC
ACCGTCATCTCGGCCAAGGTCCACTATCTCGGCGTCCAGTCTGTCCTCATCACCGTGACAGGCTTTGTCGTCTCC
TTGTCTCTCTCCTTCCGATCTTCGACCGCATACGAGCGCTACACCGAGGGGAGAAAGTACTGGGCAACTCTCGTC
CAGGCGTCGCAGATCCTGGGACGTGTCTTCTGGATCCACGCCACGGATCGAGGCAGCGAGTTCGACGCCCGCGAG
GTTCTCCTGCAGAAGCTGAGTTCGATGAACCTGCTTGTCGCCTTCTCGTTGGCCCTCAAACACAGCCTACGATTC
GAGCCCTACACGGCCTACCCAGACCTGCAAAACCTCATCGGCCACCTCGACACGTTTGCCAAATCAGCGACCGAG
GCGCAGGGATCGATTTCAACCGCGCATAAGAAGAAGTTCTTCCGCGGTGTGGGCGAGTACCTCGGCGTCTCCTTC
GCCGCAAGCAACCCTCGAAAGGCGATCAAGAAAGCCTCGCGTCCCTTGGGCAACCTGCCCCTGGAGATTCTGAGC
CACCTGGCCGTGACAATTGACACGCTGGTGGCGAATGAACAGCTTCGAGTTCCCATACACCAGACCATGGCCTTC
AATGCCCTGCAGTCGCTCAACGACGTCATGACGGGCACCGAGCGCGTCCTCTGCACGCCCCTGCCCATCGCCTAC
ACCATCGCCATTTCGCAGTCGACCTATCTGTACATCGCCCTGCTGCCGTTCCAGCTGATTCCGCTGCTGCAGTGG
ACCGCGATCCCGGCGACCATCGCAGCTAGCTGGATCATCCTCGGCCTGCTCTTCATCGGGCAGGAAGTCGAAAAC
CCCTTTGGGCAGGATGTCAACGACCTGCCGCTCGACAGCTACTGCGAGCAGATTGCCGCAGACCTGGACATCATC
GCCTCCTTCGACATGCGCGAATCTAGAAAGTTCCTAACGAGTAGCAACAACTTGCCGCTGTACCCCGTCAGCACG
GCACCTGTCAGTGTCTGGATGCAGCGCAGCGAAGAGAAGCTACGCGAGGCCATCAAGCAGAAGCCCGTCAAGACG
TTCGAGTGGCGACGATGGGGAACCAAACATTGCAGTTCCAGTGCGGCAACCAGCGTCGCAGGCGATCACAACGTC
TAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail