Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8366
Gene name
LocationContig_540:200..1508
Strand+
Gene length (bp)1308
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.7E-27 32 391
PF00083 Sugar_tr Sugar (and other) transporter 4.4E-08 29 154

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 9 392 3.0E-32
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 9 403 2.0E-24
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 2 217 4.0E-24
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 9 306 7.0E-20
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 24 150 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 9 392 3.0E-32
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 9 403 2.0E-24
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 2 217 4.0E-24
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 9 306 7.0E-20
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 24 150 2.0E-10
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 24 198 2.0E-10
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 24 307 1.0E-09
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 5 153 2.0E-09
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 29 161 1.0E-07
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 29 161 1.0E-07
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 29 161 1.0E-07
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 29 161 1.0E-07
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 29 161 1.0E-07
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 29 161 1.0E-07
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 29 161 1.0E-07
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 32 154 1.0E-07
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 10 153 2.0E-07
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 28 140 7.0E-07
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 6 153 8.0E-07
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 27 161 1.0E-06
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 28 142 2.0E-06
sp|P55705|Y4XM_RHISN Uncharacterized MFS-type transporter y4xM OS=Rhizobium sp. (strain NGR234) GN=NGR_a00760 PE=3 SV=1 50 144 2.0E-06
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 28 152 2.0E-06
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 28 178 3.0E-06
sp|D2BX50|MDTG_DICD5 Multidrug resistance protein MdtG OS=Dickeya dadantii (strain Ech586) GN=mdtG PE=3 SV=1 6 99 6.0E-06
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 32 152 6.0E-06
sp|P77726|YAJR_ECOLI Inner membrane transport protein YajR OS=Escherichia coli (strain K12) GN=yajR PE=1 SV=2 34 171 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 63 85 22
3 89 108 19
4 121 143 22
5 163 185 22
6 231 253 22
7 273 292 19
8 304 326 22
9 336 358 22
10 371 390 19
11 405 427 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8366
MTEPVAFFSIFPYVAQMVQRNGRLPAADTGFYSGLVESLFSLAQMCCTLFWGRLADRVGRRPVLVGSLVGTALGS
ALFGLAASVGDMCLFRGLAGAVSGSSLVVRTVIGDRSTPRTQARAFSWFGFAGNVGIFLGPLLGGALADPARQMP
ALFGRLAFFASYPYALPGFVIAAIVALGALACALFLEETLDRKTRPGDGGGGDGGDGEGLGPPEQRPGTDMSLVQ
LVRAPGVAVVLAVYSHVMLLAFVFTAILPLALYTPVSLGGIGCSSFGISIYMAVQGGSQALWLLLVFPRLQRRLG
TRGVLRFCAFAYPPFFVGYILMNALLRQGSEPSVVCFWIICSVVVVVGPCVSMSFTCVQLAIQDVSPHPHLLGTL
NALALTLASAIRSFAPGLSTALYAVGVRNHVLYGHLAWVLLIPLSAVLGIVLKWLPESVS*
Coding >Hirsu2|8366
ATGACGGAGCCAGTCGCTTTCTTCTCCATCTTCCCGTACGTGGCGCAGATGGTGCAGCGCAACGGCCGGCTGCCG
GCCGCCGACACGGGCTTCTATAGCGGCCTGGTCGAGTCGCTCTTCTCGCTGGCCCAGATGTGCTGCACGCTGTTC
TGGGGCCGGCTCGCGGACCGGGTCGGGCGCCGGCCCGTCCTGGTCGGCAGCCTCGTCGGCACCGCCCTCGGCTCC
GCCCTCTTCGGCCTGGCCGCCAGCGTCGGCGACATGTGCCTGTTCCGCGGCCTGGCCGGCGCCGTCTCCGGCTCC
AGCCTTGTCGTCCGCACCGTCATCGGCGACCGCAGCACGCCCCGCACCCAGGCCCGCGCCTTCAGCTGGTTCGGC
TTCGCCGGCAACGTCGGCATCTTCCTCGGGCCCTTGCTCGGCGGCGCCCTCGCCGACCCGGCCCGCCAGATGCCC
GCCCTGTTCGGCCGCCTCGCCTTCTTCGCCAGCTACCCGTACGCCCTGCCGGGCTTCGTCATCGCCGCCATCGTC
GCCCTCGGCGCCCTCGCCTGCGCCCTCTTCCTCGAGGAGACGCTCGACCGGAAGACGCGGCCGGGCGATGGCGGC
GGCGGCGACGGCGGCGACGGCGAGGGCCTCGGCCCGCCTGAGCAACGCCCCGGTACCGACATGTCCCTCGTCCAG
CTGGTCAGGGCCCCCGGTGTCGCCGTCGTCCTCGCCGTCTACAGCCACGTCATGCTGCTGGCCTTCGTCTTCACC
GCCATCCTCCCCCTCGCCCTGTACACGCCCGTGTCGCTCGGCGGCATCGGATGCTCCTCCTTCGGCATCTCCATC
TACATGGCCGTCCAGGGCGGCAGCCAGGCGCTGTGGCTGCTCCTCGTCTTCCCCCGGCTCCAGCGCCGCCTGGGC
ACCCGAGGCGTCCTCCGCTTCTGCGCCTTCGCCTACCCGCCCTTCTTCGTCGGCTACATCCTCATGAACGCCCTG
TTGCGCCAGGGGAGCGAGCCGTCCGTCGTCTGCTTCTGGATCATCTGCTCCGTCGTCGTCGTGGTCGGCCCCTGC
GTGAGCATGTCCTTCACTTGCGTCCAGCTGGCCATTCAGGACGTCTCGCCTCATCCCCATCTGCTCGGCACCCTC
AACGCCCTCGCCCTCACCCTGGCGAGCGCCATTCGCTCCTTTGCGCCGGGCCTTTCGACCGCTCTCTACGCCGTT
GGCGTGAGGAATCATGTCCTGTACGGCCATCTTGCCTGGGTGCTTCTGATTCCGCTATCCGCCGTGCTCGGAATC
GTACTGAAGTGGCTACCCGAGTCAGTGAGCTAG
Transcript >Hirsu2|8366
ATGACGGAGCCAGTCGCTTTCTTCTCCATCTTCCCGTACGTGGCGCAGATGGTGCAGCGCAACGGCCGGCTGCCG
GCCGCCGACACGGGCTTCTATAGCGGCCTGGTCGAGTCGCTCTTCTCGCTGGCCCAGATGTGCTGCACGCTGTTC
TGGGGCCGGCTCGCGGACCGGGTCGGGCGCCGGCCCGTCCTGGTCGGCAGCCTCGTCGGCACCGCCCTCGGCTCC
GCCCTCTTCGGCCTGGCCGCCAGCGTCGGCGACATGTGCCTGTTCCGCGGCCTGGCCGGCGCCGTCTCCGGCTCC
AGCCTTGTCGTCCGCACCGTCATCGGCGACCGCAGCACGCCCCGCACCCAGGCCCGCGCCTTCAGCTGGTTCGGC
TTCGCCGGCAACGTCGGCATCTTCCTCGGGCCCTTGCTCGGCGGCGCCCTCGCCGACCCGGCCCGCCAGATGCCC
GCCCTGTTCGGCCGCCTCGCCTTCTTCGCCAGCTACCCGTACGCCCTGCCGGGCTTCGTCATCGCCGCCATCGTC
GCCCTCGGCGCCCTCGCCTGCGCCCTCTTCCTCGAGGAGACGCTCGACCGGAAGACGCGGCCGGGCGATGGCGGC
GGCGGCGACGGCGGCGACGGCGAGGGCCTCGGCCCGCCTGAGCAACGCCCCGGTACCGACATGTCCCTCGTCCAG
CTGGTCAGGGCCCCCGGTGTCGCCGTCGTCCTCGCCGTCTACAGCCACGTCATGCTGCTGGCCTTCGTCTTCACC
GCCATCCTCCCCCTCGCCCTGTACACGCCCGTGTCGCTCGGCGGCATCGGATGCTCCTCCTTCGGCATCTCCATC
TACATGGCCGTCCAGGGCGGCAGCCAGGCGCTGTGGCTGCTCCTCGTCTTCCCCCGGCTCCAGCGCCGCCTGGGC
ACCCGAGGCGTCCTCCGCTTCTGCGCCTTCGCCTACCCGCCCTTCTTCGTCGGCTACATCCTCATGAACGCCCTG
TTGCGCCAGGGGAGCGAGCCGTCCGTCGTCTGCTTCTGGATCATCTGCTCCGTCGTCGTCGTGGTCGGCCCCTGC
GTGAGCATGTCCTTCACTTGCGTCCAGCTGGCCATTCAGGACGTCTCGCCTCATCCCCATCTGCTCGGCACCCTC
AACGCCCTCGCCCTCACCCTGGCGAGCGCCATTCGCTCCTTTGCGCCGGGCCTTTCGACCGCTCTCTACGCCGTT
GGCGTGAGGAATCATGTCCTGTACGGCCATCTTGCCTGGGTGCTTCTGATTCCGCTATCCGCCGTGCTCGGAATC
GTACTGAAGTGGCTACCCGAGTCAGTGAGCTAG
Gene >Hirsu2|8366
ATGACGGAGCCAGTCGCTTTCTTCTCCATCTTCCCGTACGTGGCGCAGATGGTGCAGCGCAACGGCCGGCTGCCG
GCCGCCGACACGGGCTTCTATAGCGGCCTGGTCGAGTCGCTCTTCTCGCTGGCCCAGATGTGCTGCACGCTGTTC
TGGGGCCGGCTCGCGGACCGGGTCGGGCGCCGGCCCGTCCTGGTCGGCAGCCTCGTCGGCACCGCCCTCGGCTCC
GCCCTCTTCGGCCTGGCCGCCAGCGTCGGCGACATGTGCCTGTTCCGCGGCCTGGCCGGCGCCGTCTCCGGCTCC
AGCCTTGTCGTCCGCACCGTCATCGGCGACCGCAGCACGCCCCGCACCCAGGCCCGCGCCTTCAGCTGGTTCGGC
TTCGCCGGCAACGTCGGCATCTTCCTCGGGCCCTTGCTCGGCGGCGCCCTCGCCGACCCGGCCCGCCAGATGCCC
GCCCTGTTCGGCCGCCTCGCCTTCTTCGCCAGCTACCCGTACGCCCTGCCGGGCTTCGTCATCGCCGCCATCGTC
GCCCTCGGCGCCCTCGCCTGCGCCCTCTTCCTCGAGGAGACGCTCGACCGGAAGACGCGGCCGGGCGATGGCGGC
GGCGGCGACGGCGGCGACGGCGAGGGCCTCGGCCCGCCTGAGCAACGCCCCGGTACCGACATGTCCCTCGTCCAG
CTGGTCAGGGCCCCCGGTGTCGCCGTCGTCCTCGCCGTCTACAGCCACGTCATGCTGCTGGCCTTCGTCTTCACC
GCCATCCTCCCCCTCGCCCTGTACACGCCCGTGTCGCTCGGCGGCATCGGATGCTCCTCCTTCGGCATCTCCATC
TACATGGCCGTCCAGGGCGGCAGCCAGGCGCTGTGGCTGCTCCTCGTCTTCCCCCGGCTCCAGCGCCGCCTGGGC
ACCCGAGGCGTCCTCCGCTTCTGCGCCTTCGCCTACCCGCCCTTCTTCGTCGGCTACATCCTCATGAACGCCCTG
TTGCGCCAGGGGAGCGAGCCGTCCGTCGTCTGCTTCTGGATCATCTGCTCCGTCGTCGTCGTGGTCGGCCCCTGC
GTGAGCATGTCCTTCACTTGCGTCCAGCTGGCCATTCAGGACGTCTCGCCTCATCCCCATCTGCTCGGCACCCTC
AACGCCCTCGCCCTCACCCTGGCGAGCGCCATTCGCTCCTTTGCGCCGGGCCTTTCGACCGCTCTCTACGCCGTT
GGCGTGAGGAATCATGTCCTGTACGGCCATCTTGCCTGGGTGCTTCTGATTCCGCTATCCGCCGTGCTCGGAATC
GTACTGAAGTGGCTACCCGAGTCAGTGAGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail