Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8361
Gene name
LocationContig_54:32665..34359
Strand+
Gene length (bp)1694
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08118 MDM31_MDM32 Yeast mitochondrial distribution and morphology (MDM) proteins 2.1E-05 7 31
PF08118 MDM31_MDM32 Yeast mitochondrial distribution and morphology (MDM) proteins 8.1E-224 32 518

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38880|MDM31_YEAST Mitochondrial distribution and morphology protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM31 PE=1 SV=1 7 520 2.0E-144
sp|Q10070|MDM31_SCHPO Mitochondrial distribution and morphology protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm31 PE=3 SV=1 25 336 2.0E-90
sp|Q753C5|MDM32_ASHGO Mitochondrial distribution and morphology protein 32 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDM32 PE=3 SV=1 3 446 2.0E-45
sp|Q6CUA4|MDM32_KLULA Mitochondrial distribution and morphology protein 32 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDM32 PE=3 SV=1 6 446 5.0E-44
sp|A7THL9|MDM32_VANPO Mitochondrial distribution and morphology protein 32 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDM32 PE=3 SV=1 4 445 6.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38880|MDM31_YEAST Mitochondrial distribution and morphology protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM31 PE=1 SV=1 7 520 2.0E-144
sp|Q10070|MDM31_SCHPO Mitochondrial distribution and morphology protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm31 PE=3 SV=1 25 336 2.0E-90
sp|Q753C5|MDM32_ASHGO Mitochondrial distribution and morphology protein 32 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDM32 PE=3 SV=1 3 446 2.0E-45
sp|Q6CUA4|MDM32_KLULA Mitochondrial distribution and morphology protein 32 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDM32 PE=3 SV=1 6 446 5.0E-44
sp|A7THL9|MDM32_VANPO Mitochondrial distribution and morphology protein 32 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDM32 PE=3 SV=1 4 445 6.0E-44
sp|Q6FMB2|MDM32_CANGA Mitochondrial distribution and morphology protein 32 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDM32 PE=3 SV=1 3 449 2.0E-42
sp|Q10070|MDM31_SCHPO Mitochondrial distribution and morphology protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm31 PE=3 SV=1 407 518 3.0E-31
sp|Q12171|MDM32_YEAST Mitochondrial distribution and morphology protein 32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM32 PE=1 SV=2 3 333 4.0E-19
sp|A6ZNZ1|MDM32_YEAS7 Mitochondrial distribution and morphology protein 32 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDM32 PE=3 SV=2 3 333 5.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0005743 mitochondrial inner membrane Yes
GO:0007005 mitochondrion organization Yes
GO:0000001 mitochondrion inheritance Yes
GO:0044446 intracellular organelle part No
GO:0009987 cellular process No
GO:0044424 intracellular part No
GO:0019866 organelle inner membrane No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No
GO:0048311 mitochondrion distribution No
GO:0006996 organelle organization No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0048308 organelle inheritance No
GO:0051179 localization No
GO:0016020 membrane No
GO:0031966 mitochondrial membrane No
GO:0051640 organelle localization No
GO:0051641 cellular localization No
GO:0031090 organelle membrane No
GO:0008150 biological_process No
GO:0044429 mitochondrial part No
GO:0051646 mitochondrion localization No
GO:0044422 organelle part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8361
MPHRPTKEELLAAANGFWERVRVRFKWMSIRMWILVGTTTFFSLIIFSINTVFAQETLAKWVGDYLTQSAGVTVV
FESAIVPKWRNGVIAFHNVYVSRRPGQVESSVSKGSSDAAAVAAAGRQVHAATSVDAEDDGNYTQFDVTIANVHV
TLSFLNWWNGKGLLKDVEVNGVRGVVDRTSVRWSPEQVDPLSYRHHHEPGDFEIESFKLEDLLLTIHQPDGFRPF
SVSIYSCELPQLRKQWLFYDFLSASHMSGSFDGSLFTIHPRQVHGIASSRDKMALTGVGESHAWKKFSRLRIDGL
KIDHLNRGVEGPFGWIYEGNVDIVADVMFPADTDDGITKVMADFYDQLEEAVITNRARLLQNSADIAPTLLRSGH
ISETSGLAAEGQPADDENGGNRSEEDRRYLIMDLRIHLNDVKAAVPLFTRDMSYVNQALVRPIVAYINAKKTYIP
IACRIIKRLGDFDGSWTVFDCGLMNDASAETYEAFAKDVEDQQSRVRRFKKVGFWTLSLAVHALFMGMAGNVV*
Coding >Hirsu2|8361
ATGCCACACCGACCGACTAAGGAGGAGCTATTGGCAGCCGCCAATGGCTTCTGGGAAAGGGTCAGGGTCCGGTTC
AAGTGGATGTCGATCAGGATGTGGATCCTGGTGGGAACGACGACATTCTTTTCCCTCATCATCTTCTCTATCAAC
ACCGTCTTCGCTCAGGAAACCCTAGCGAAGTGGGTTGGCGACTACCTCACTCAATCGGCTGGTGTTACCGTCGTT
TTCGAGTCGGCTATCGTACCCAAGTGGAGGAACGGGGTCATCGCATTTCACAACGTCTACGTCTCGCGGCGGCCG
GGTCAAGTCGAGTCGTCCGTTAGCAAGGGGTCGTCGGACGCGGCCGCAGTGGCCGCCGCAGGGCGACAAGTGCAC
GCTGCTACGTCTGTCGATGCGGAGGATGACGGCAACTACACGCAGTTCGACGTGACCATCGCCAACGTCCACGTC
ACATTGTCCTTCCTCAACTGGTGGAATGGCAAGGGGCTACTCAAGGACGTCGAGGTGAATGGCGTCAGGGGTGTC
GTTGACCGGACATCGGTGCGCTGGTCACCGGAGCAGGTCGACCCTTTGTCTTATCGCCATCATCACGAACCCGGG
GACTTTGAGATTGAGTCGTTCAAGCTTGAAGACCTCTTACTGACGATACACCAACCGGATGGATTCCGGCCCTTT
TCGGTCAGCATCTATTCATGCGAATTACCCCAGCTGCGTAAACAATGGCTGTTTTACGACTTCTTGTCGGCCAGC
CACATGTCCGGCTCCTTTGACGGCTCTCTGTTCACCATCCATCCTCGGCAGGTGCACGGCATAGCCTCGAGTCGT
GACAAGATGGCCCTGACAGGCGTTGGGGAGTCGCATGCCTGGAAGAAGTTCAGCAGGCTCAGGATCGACGGCCTG
AAGATCGACCATCTGAATCGCGGCGTCGAAGGGCCCTTTGGCTGGATCTACGAGGGCAATGTCGACATTGTGGCG
GATGTCATGTTCCCGGCCGACACGGACGACGGCATCACCAAGGTCATGGCCGATTTCTACGACCAGCTCGAGGAG
GCAGTCATCACGAACCGAGCTCGCCTGCTCCAGAACAGTGCGGACATTGCACCCACCCTGCTCCGATCGGGGCAC
ATTTCCGAAACATCGGGCCTCGCCGCGGAGGGCCAGCCGGCGGACGACGAGAATGGCGGGAATCGAAGCGAGGAG
GACCGCCGCTATCTCATCATGGATCTTCGGATCCATCTCAACGACGTCAAGGCCGCCGTGCCTCTGTTCACACGC
GACATGTCGTACGTCAACCAGGCACTAGTGCGGCCCATCGTCGCGTACATCAACGCCAAGAAGACGTACATACCC
ATCGCCTGTCGCATCATCAAGCGGCTCGGCGACTTCGACGGCAGCTGGACCGTCTTCGACTGCGGCCTCATGAAC
GACGCATCGGCCGAGACGTACGAGGCATTCGCCAAGGACGTCGAGGACCAACAGAGCCGCGTCCGACGCTTCAAG
AAGGTTGGCTTCTGGACGCTGTCCCTGGCCGTGCACGCGCTCTTCATGGGCATGGCCGGCAATGTTGTATGA
Transcript >Hirsu2|8361
ATGCCACACCGACCGACTAAGGAGGAGCTATTGGCAGCCGCCAATGGCTTCTGGGAAAGGGTCAGGGTCCGGTTC
AAGTGGATGTCGATCAGGATGTGGATCCTGGTGGGAACGACGACATTCTTTTCCCTCATCATCTTCTCTATCAAC
ACCGTCTTCGCTCAGGAAACCCTAGCGAAGTGGGTTGGCGACTACCTCACTCAATCGGCTGGTGTTACCGTCGTT
TTCGAGTCGGCTATCGTACCCAAGTGGAGGAACGGGGTCATCGCATTTCACAACGTCTACGTCTCGCGGCGGCCG
GGTCAAGTCGAGTCGTCCGTTAGCAAGGGGTCGTCGGACGCGGCCGCAGTGGCCGCCGCAGGGCGACAAGTGCAC
GCTGCTACGTCTGTCGATGCGGAGGATGACGGCAACTACACGCAGTTCGACGTGACCATCGCCAACGTCCACGTC
ACATTGTCCTTCCTCAACTGGTGGAATGGCAAGGGGCTACTCAAGGACGTCGAGGTGAATGGCGTCAGGGGTGTC
GTTGACCGGACATCGGTGCGCTGGTCACCGGAGCAGGTCGACCCTTTGTCTTATCGCCATCATCACGAACCCGGG
GACTTTGAGATTGAGTCGTTCAAGCTTGAAGACCTCTTACTGACGATACACCAACCGGATGGATTCCGGCCCTTT
TCGGTCAGCATCTATTCATGCGAATTACCCCAGCTGCGTAAACAATGGCTGTTTTACGACTTCTTGTCGGCCAGC
CACATGTCCGGCTCCTTTGACGGCTCTCTGTTCACCATCCATCCTCGGCAGGTGCACGGCATAGCCTCGAGTCGT
GACAAGATGGCCCTGACAGGCGTTGGGGAGTCGCATGCCTGGAAGAAGTTCAGCAGGCTCAGGATCGACGGCCTG
AAGATCGACCATCTGAATCGCGGCGTCGAAGGGCCCTTTGGCTGGATCTACGAGGGCAATGTCGACATTGTGGCG
GATGTCATGTTCCCGGCCGACACGGACGACGGCATCACCAAGGTCATGGCCGATTTCTACGACCAGCTCGAGGAG
GCAGTCATCACGAACCGAGCTCGCCTGCTCCAGAACAGTGCGGACATTGCACCCACCCTGCTCCGATCGGGGCAC
ATTTCCGAAACATCGGGCCTCGCCGCGGAGGGCCAGCCGGCGGACGACGAGAATGGCGGGAATCGAAGCGAGGAG
GACCGCCGCTATCTCATCATGGATCTTCGGATCCATCTCAACGACGTCAAGGCCGCCGTGCCTCTGTTCACACGC
GACATGTCGTACGTCAACCAGGCACTAGTGCGGCCCATCGTCGCGTACATCAACGCCAAGAAGACGTACATACCC
ATCGCCTGTCGCATCATCAAGCGGCTCGGCGACTTCGACGGCAGCTGGACCGTCTTCGACTGCGGCCTCATGAAC
GACGCATCGGCCGAGACGTACGAGGCATTCGCCAAGGACGTCGAGGACCAACAGAGCCGCGTCCGACGCTTCAAG
AAGGTTGGCTTCTGGACGCTGTCCCTGGCCGTGCACGCGCTCTTCATGGGCATGGCCGGCAATGTTGTATGA
Gene >Hirsu2|8361
ATGCCACACCGACCGACTAAGGAGGAGCTATTGGCAGCCGCCAATGGCTTCTGGGAAAGGGTCAGGGTCCGGTTC
AAGTGGATGTCGATCAGGAGTATGCGACCCTGGAATGTCGACGAATGGGGGGCATTTGTTTCGTGGTTCATGCTT
GGGCATCTAGTGTGGATCCTGGTGGGAACGACGACATTCTTTTCCCTCATCATCTTCTCTATCAACACCGTCTTC
GCTCAGGGTATTTACCGGCCTCGTCTACCAGGCGAACCTGCCGTCGTGCTAACTGCGCTTTAGAAACCCTAGCGA
AGTGGGTTGGCGACTACCTCACTCAATCGGCTGGTGTTACCGTCGTTTTCGAGTCGGCTATCGTACCCAAGTGGA
GGAACGGGGTCATCGCATTTCACAACGTCTACGTCTCGCGGCGGCCGGGTCAAGTCGAGTCGTCCGTTAGCAAGG
GGTCGTCGGACGCGGCCGCAGTGGCCGCCGCAGGGCGACAAGTGCACGCTGCTACGTCTGTCGATGCGGAGGATG
ACGGCAACTACACGCAGTTCGACGTGACCATCGCCAACGTCCACGTCACATTGTCCTTCCTCAACTGGTGGAATG
GCAAGGGGCTACTCAAGGACGTCGAGGTGAATGGCGTCAGGGGTGTCGTTGACCGGACATCGGTGCGCTGGTCAC
CGGAGCAGGTCGACCCTTTGTCTTATCGCCATCATCACGAACCCGGGGACTTTGAGATTGAGTCGTTCAAGCTTG
AAGACCTCTTACTGACGATACACCAACCGGATGGATTCCGGCCCTTTTCGGTCAGCATCTATTCATGCGAATTAC
CCCAGCTGCGTAAACAATGGCTGTTTTACGACTTCTTGTCGGCCAGCCACATGTCCGGCTCCTTTGACGGCTCTC
TGTTCACCATCCATCCTCGGCAGGTGCACGGCATAGCCTCGAGTCGTGACAAGATGGCCCTGACAGGCGTTGGGG
AGTCGCATGCCTGGAAGAAGTTCAGCAGGCTCAGGATCGACGGCCTGAAGATCGACCATCTGAATCGCGGCGTCG
AAGGGCCCTTTGGCTGGATCTACGAGGGCAATGTCGACATTGTGGCGGATGTCATGTTCCCGGCCGACACGGACG
ACGGCATCACCAAGGTCATGGCCGATTTCTACGACCAGCTCGAGGAGGCAGTCATCACGAACCGAGCTCGCCTGC
TCCAGAACAGTGCGGACATTGCACCCACCCTGCTCCGATCGGGGCACATTTCCGAAACATCGGGCCTCGCCGCGG
AGGGCCAGCCGGCGGACGACGAGAATGGCGGGAATCGAAGCGAGGAGGACCGCCGCTATCTCATCATGGATCTTC
GGATCCATCTCAACGACGTCAAGGCCGCCGTGCCTCTGTTCACACGCGACATGTCGTACGTCAACCAGGCACTAG
TGCGGCCCATCGTCGCGTACATCAACGCCAAGAAGACGTACATACCCATCGCCTGTCGCATCATCAAGCGGCTCG
GCGACTTCGACGGCAGCTGGACCGTCTTCGACTGCGGCCTCATGAACGACGCATCGGCCGAGACGTACGAGGCAT
TCGCCAAGGACGTCGAGGACCAACAGAGCCGCGTCCGACGCTTCAAGAAGGTTGGCTTCTGGACGCTGTCCCTGG
CCGTGCACGCGCTCTTCATGGGCATGGCCGGCAATGTTGTATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail