Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|836
Gene name
LocationContig_1175:2226..2934
Strand+
Gene length (bp)708
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00156 Pribosyltran Phosphoribosyl transferase domain 2.3E-12 53 173

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42767|PYRE_METAN Orotate phosphoribosyltransferase OS=Metarhizium anisopliae GN=URA5 PE=3 SV=1 5 235 1.0E-141
sp|P21846|PYRE_HYPJE Orotate phosphoribosyltransferase OS=Hypocrea jecorina GN=ura5 PE=3 SV=1 1 235 1.0E-133
sp|P35788|PYRE_COLGR Orotate phosphoribosyltransferase OS=Colletotrichum graminicola GN=PYR1 PE=3 SV=1 4 235 5.0E-121
sp|Q7RVF7|PYRE_NEUCR Orotate phosphoribosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ura-5 PE=3 SV=1 6 235 5.0E-121
sp|P18904|PYRE_SORMA Orotate phosphoribosyltransferase OS=Sordaria macrospora GN=URA5 PE=3 SV=1 9 235 1.0E-115
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42767|PYRE_METAN Orotate phosphoribosyltransferase OS=Metarhizium anisopliae GN=URA5 PE=3 SV=1 5 235 1.0E-141
sp|P21846|PYRE_HYPJE Orotate phosphoribosyltransferase OS=Hypocrea jecorina GN=ura5 PE=3 SV=1 1 235 1.0E-133
sp|P35788|PYRE_COLGR Orotate phosphoribosyltransferase OS=Colletotrichum graminicola GN=PYR1 PE=3 SV=1 4 235 5.0E-121
sp|Q7RVF7|PYRE_NEUCR Orotate phosphoribosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ura-5 PE=3 SV=1 6 235 5.0E-121
sp|P18904|PYRE_SORMA Orotate phosphoribosyltransferase OS=Sordaria macrospora GN=URA5 PE=3 SV=1 9 235 1.0E-115
sp|P08309|PYRE_PODAS Orotate phosphoribosyltransferase OS=Podospora anserina GN=URA5 PE=3 SV=1 4 235 2.0E-102
sp|O13474|PYRE_KLULA Orotate phosphoribosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URA5 PE=3 SV=1 3 234 9.0E-70
sp|P41923|PYRE_YARLI Orotate phosphoribosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=URA5 PE=3 SV=1 6 231 6.0E-67
sp|P13298|PYRE_YEAST Orotate phosphoribosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA5 PE=1 SV=2 3 234 3.0E-64
sp|O93849|PYRE_COCP7 Orotate phosphoribosyltransferase OS=Coccidioides posadasii (strain C735) GN=URA5 PE=3 SV=1 7 235 1.0E-62
sp|Q1DNB0|PYRE_COCIM Orotate phosphoribosyltransferase OS=Coccidioides immitis (strain RS) GN=URA5 PE=3 SV=1 7 235 1.0E-62
sp|Q7W3H5|PYRE_BORPA Orotate phosphoribosyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pyrE PE=3 SV=2 12 231 1.0E-59
sp|P30402|PYRX_YEAST Orotate phosphoribosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA10 PE=1 SV=3 2 231 3.0E-59
sp|O94331|PYRE_SCHPO Orotate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura5 PE=3 SV=1 9 233 4.0E-59
sp|Q7WEU9|PYRE_BORBR Orotate phosphoribosyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pyrE PE=3 SV=2 12 231 4.0E-59
sp|A4VGS1|PYRE_PSEU5 Orotate phosphoribosyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=pyrE PE=3 SV=1 6 231 3.0E-58
sp|Q7VSN4|PYRE_BORPE Orotate phosphoribosyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pyrE PE=3 SV=1 12 231 3.0E-58
sp|Q3SM42|PYRE_THIDA Orotate phosphoribosyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pyrE PE=3 SV=1 6 231 5.0E-58
sp|A7MQA9|PYRE_CROS8 Orotate phosphoribosyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pyrE PE=3 SV=1 9 231 8.0E-58
sp|B1JQX7|PYRE_YERPY Orotate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pyrE PE=3 SV=1 6 234 1.0E-56
sp|Q66GE0|PYRE_YERPS Orotate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pyrE PE=3 SV=1 6 234 1.0E-56
sp|A4TSE1|PYRE_YERPP Orotate phosphoribosyltransferase OS=Yersinia pestis (strain Pestoides F) GN=pyrE PE=3 SV=1 6 234 1.0E-56
sp|Q1CCZ8|PYRE_YERPN Orotate phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pyrE PE=3 SV=1 6 234 1.0E-56
sp|A9R670|PYRE_YERPG Orotate phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pyrE PE=3 SV=1 6 234 1.0E-56
sp|Q8ZJP7|PYRE_YERPE Orotate phosphoribosyltransferase OS=Yersinia pestis GN=pyrE PE=3 SV=1 6 234 1.0E-56
sp|B2JYM9|PYRE_YERPB Orotate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pyrE PE=3 SV=1 6 234 1.0E-56
sp|Q1C263|PYRE_YERPA Orotate phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pyrE PE=3 SV=1 6 234 1.0E-56
sp|A7FCT0|PYRE_YERP3 Orotate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pyrE PE=3 SV=1 6 234 1.0E-56
sp|A1JHW8|PYRE_YERE8 Orotate phosphoribosyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pyrE PE=3 SV=1 9 231 4.0E-56
sp|A4SHC9|PYRE_AERS4 Orotate phosphoribosyltransferase OS=Aeromonas salmonicida (strain A449) GN=pyrE PE=3 SV=1 6 231 2.0E-55
sp|B8F557|PYRE_HAEPS Orotate phosphoribosyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pyrE PE=3 SV=1 6 231 3.0E-55
sp|Q2S8N8|PYRE_HAHCH Orotate phosphoribosyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=pyrE PE=3 SV=1 6 231 3.0E-55
sp|B0U1J0|PYRE_XYLFM Orotate phosphoribosyltransferase OS=Xylella fastidiosa (strain M12) GN=pyrE PE=3 SV=1 6 217 5.0E-55
sp|B2I6N0|PYRE_XYLF2 Orotate phosphoribosyltransferase OS=Xylella fastidiosa (strain M23) GN=pyrE PE=3 SV=1 6 217 5.0E-55
sp|A6SUD4|PYRE_JANMA Orotate phosphoribosyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=pyrE PE=3 SV=1 6 231 5.0E-55
sp|Q329L4|PYRE_SHIDS Orotate phosphoribosyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pyrE PE=3 SV=1 9 231 6.0E-55
sp|Q87F16|PYRE_XYLFT Orotate phosphoribosyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pyrE PE=3 SV=1 6 217 7.0E-55
sp|Q1LS40|PYRE_CUPMC Orotate phosphoribosyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pyrE PE=3 SV=1 8 231 2.0E-54
sp|A6TFN4|PYRE_KLEP7 Orotate phosphoribosyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pyrE PE=3 SV=1 9 231 2.0E-54
sp|Q0SYG9|PYRE_SHIF8 Orotate phosphoribosyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=pyrE PE=3 SV=1 9 231 2.0E-54
sp|B6I3L9|PYRE_ECOSE Orotate phosphoribosyltransferase OS=Escherichia coli (strain SE11) GN=pyrE PE=3 SV=1 9 231 2.0E-54
sp|A7ZTJ3|PYRE_ECO24 Orotate phosphoribosyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pyrE PE=3 SV=1 9 231 2.0E-54
sp|Q9PGZ3|PYRE_XYLFA Orotate phosphoribosyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=pyrE PE=3 SV=1 6 217 3.0E-54
sp|Q6F6Z6|PYRE_ACIAD Orotate phosphoribosyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pyrE PE=3 SV=2 11 231 4.0E-54
sp|Q83J15|PYRE_SHIFL Orotate phosphoribosyltransferase OS=Shigella flexneri GN=pyrE PE=3 SV=4 6 231 5.0E-54
sp|Q31UY4|PYRE_SHIBS Orotate phosphoribosyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=pyrE PE=3 SV=1 9 231 5.0E-54
sp|B2TTV6|PYRE_SHIB3 Orotate phosphoribosyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pyrE PE=3 SV=1 9 231 5.0E-54
sp|B5YWE0|PYRE_ECO5E Orotate phosphoribosyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pyrE PE=3 SV=1 9 231 5.0E-54
sp|Q8XD99|PYRE_ECO57 Orotate phosphoribosyltransferase OS=Escherichia coli O157:H7 GN=pyrE PE=3 SV=3 9 231 5.0E-54
sp|A9MKN3|PYRE_SALAR Orotate phosphoribosyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pyrE PE=3 SV=1 9 213 6.0E-54
sp|B2FJX2|PYRE_STRMK Orotate phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=pyrE PE=3 SV=1 6 231 6.0E-54
sp|A1TY28|PYRE_MARHV Orotate phosphoribosyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pyrE PE=3 SV=1 6 231 6.0E-54
sp|B1LK79|PYRE_ECOSM Orotate phosphoribosyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pyrE PE=3 SV=1 9 231 7.0E-54
sp|A5CVN5|PYRE_VESOH Orotate phosphoribosyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=pyrE PE=3 SV=1 6 209 8.0E-54
sp|B7LVK4|PYRE_ESCF3 Orotate phosphoribosyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|B7NEU6|PYRE_ECOLU Orotate phosphoribosyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|P0A7E3|PYRE_ECOLI Orotate phosphoribosyltransferase OS=Escherichia coli (strain K12) GN=pyrE PE=1 SV=2 9 231 8.0E-54
sp|B1IYV8|PYRE_ECOLC Orotate phosphoribosyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|P0A7E4|PYRE_ECOL6 Orotate phosphoribosyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pyrE PE=3 SV=2 9 231 8.0E-54
sp|Q0TBG7|PYRE_ECOL5 Orotate phosphoribosyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|A8A6A4|PYRE_ECOHS Orotate phosphoribosyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|B1X976|PYRE_ECODH Orotate phosphoribosyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|C4ZXN4|PYRE_ECOBW Orotate phosphoribosyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|B7M4C7|PYRE_ECO8A Orotate phosphoribosyltransferase OS=Escherichia coli O8 (strain IAI1) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|B7N1U3|PYRE_ECO81 Orotate phosphoribosyltransferase OS=Escherichia coli O81 (strain ED1a) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|B7L766|PYRE_ECO55 Orotate phosphoribosyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|B7UM49|PYRE_ECO27 Orotate phosphoribosyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pyrE PE=3 SV=1 9 231 8.0E-54
sp|A8GLE9|PYRE_SERP5 Orotate phosphoribosyltransferase OS=Serratia proteamaculans (strain 568) GN=pyrE PE=3 SV=1 6 231 9.0E-54
sp|B7NQ04|PYRE_ECO7I Orotate phosphoribosyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pyrE PE=3 SV=1 9 231 9.0E-54
sp|Q48Q10|PYRE_PSE14 Orotate phosphoribosyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pyrE PE=3 SV=1 6 231 1.0E-53
sp|C6DIC6|PYRE_PECCP Orotate phosphoribosyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pyrE PE=3 SV=1 6 209 1.0E-53
sp|Q3YW04|PYRE_SHISS Orotate phosphoribosyltransferase OS=Shigella sonnei (strain Ss046) GN=pyrE PE=3 SV=1 9 231 1.0E-53
sp|B7MFK3|PYRE_ECO45 Orotate phosphoribosyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pyrE PE=3 SV=1 9 231 1.0E-53
sp|B4STF6|PYRE_STRM5 Orotate phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=pyrE PE=3 SV=1 6 231 1.0E-53
sp|Q2KU70|PYRE_BORA1 Orotate phosphoribosyltransferase OS=Bordetella avium (strain 197N) GN=pyrE PE=3 SV=1 12 231 1.0E-53
sp|Q1QSL0|PYRE_CHRSD Orotate phosphoribosyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pyrE PE=3 SV=1 5 233 2.0E-53
sp|A4W507|PYRE_ENT38 Orotate phosphoribosyltransferase OS=Enterobacter sp. (strain 638) GN=pyrE PE=3 SV=1 9 231 2.0E-53
sp|Q3J6V6|PYRE_NITOC Orotate phosphoribosyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pyrE PE=3 SV=1 6 231 3.0E-53
sp|Q7MY25|PYRE_PHOLL Orotate phosphoribosyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pyrE PE=3 SV=1 6 231 4.0E-53
sp|Q88BD7|PYRE_PSESM Orotate phosphoribosyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pyrE PE=3 SV=1 6 231 4.0E-53
sp|B5XTG0|PYRE_KLEP3 Orotate phosphoribosyltransferase OS=Klebsiella pneumoniae (strain 342) GN=pyrE PE=3 SV=1 9 231 5.0E-53
sp|B0BT67|PYRE_ACTPJ Orotate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pyrE PE=3 SV=1 6 231 5.0E-53
sp|B3H0G3|PYRE_ACTP7 Orotate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pyrE PE=3 SV=1 6 231 5.0E-53
sp|A3MZ36|PYRE_ACTP2 Orotate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pyrE PE=3 SV=1 6 231 5.0E-53
sp|B4F0W4|PYRE_PROMH Orotate phosphoribosyltransferase OS=Proteus mirabilis (strain HI4320) GN=pyrE PE=3 SV=1 9 231 6.0E-53
sp|A3M9Y5|PYRE_ACIBT Orotate phosphoribosyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=pyrE PE=3 SV=1 9 231 7.0E-53
sp|B2I1J9|PYRE_ACIBC Orotate phosphoribosyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=pyrE PE=3 SV=1 9 231 1.0E-52
sp|A1WZE3|PYRE_HALHL Orotate phosphoribosyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pyrE PE=3 SV=1 6 233 1.0E-52
sp|Q65W02|PYRE_MANSM Orotate phosphoribosyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pyrE PE=3 SV=1 6 231 1.0E-52
sp|Q4ZZY3|PYRE_PSEU2 Orotate phosphoribosyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pyrE PE=3 SV=1 6 231 2.0E-52
sp|B7ICE9|PYRE_ACIB5 Orotate phosphoribosyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=pyrE PE=3 SV=1 9 231 2.0E-52
sp|B7GV69|PYRE_ACIB3 Orotate phosphoribosyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=pyrE PE=3 SV=1 9 231 2.0E-52
sp|A4G1L0|PYRE_HERAR Orotate phosphoribosyltransferase OS=Herminiimonas arsenicoxydans GN=pyrE PE=3 SV=1 6 234 2.0E-52
sp|Q0KF45|PYRE_CUPNH Orotate phosphoribosyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pyrE PE=3 SV=1 3 231 2.0E-52
sp|P08870|PYRE_SALTY Orotate phosphoribosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pyrE PE=1 SV=3 9 231 3.0E-52
sp|B4TZY3|PYRE_SALSV Orotate phosphoribosyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=pyrE PE=3 SV=1 9 231 3.0E-52
sp|C0Q1X4|PYRE_SALPC Orotate phosphoribosyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=pyrE PE=3 SV=1 9 231 3.0E-52
sp|A9MVN7|PYRE_SALPB Orotate phosphoribosyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pyrE PE=3 SV=1 9 231 3.0E-52
sp|B4SXE3|PYRE_SALNS Orotate phosphoribosyltransferase OS=Salmonella newport (strain SL254) GN=pyrE PE=3 SV=1 9 231 3.0E-52
sp|B4T9Y5|PYRE_SALHS Orotate phosphoribosyltransferase OS=Salmonella heidelberg (strain SL476) GN=pyrE PE=3 SV=1 9 231 3.0E-52
sp|B5RG81|PYRE_SALG2 Orotate phosphoribosyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pyrE PE=3 SV=1 9 231 3.0E-52
sp|B5R5G6|PYRE_SALEP Orotate phosphoribosyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=pyrE PE=3 SV=1 9 231 3.0E-52
sp|B5FM65|PYRE_SALDC Orotate phosphoribosyltransferase OS=Salmonella dublin (strain CT_02021853) GN=pyrE PE=3 SV=1 9 231 3.0E-52
sp|Q57IA0|PYRE_SALCH Orotate phosphoribosyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=pyrE PE=3 SV=1 9 231 3.0E-52
sp|B2VF77|PYRE_ERWT9 Orotate phosphoribosyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pyrE PE=3 SV=1 6 231 3.0E-52
sp|Q2YCI8|PYRE_NITMU Orotate phosphoribosyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=pyrE PE=3 SV=1 6 233 3.0E-52
sp|B4S200|PYRE_ALTMD Orotate phosphoribosyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=pyrE1 PE=3 SV=1 6 231 5.0E-52
sp|Q7MPT2|PYRE_VIBVY Orotate phosphoribosyltransferase OS=Vibrio vulnificus (strain YJ016) GN=pyrE PE=3 SV=1 6 231 7.0E-52
sp|B5EXE6|PYRE_SALA4 Orotate phosphoribosyltransferase OS=Salmonella agona (strain SL483) GN=pyrE PE=3 SV=1 9 231 7.0E-52
sp|A6VED8|PYRE_PSEA7 Orotate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=pyrE PE=3 SV=1 6 231 8.0E-52
sp|B5FFE3|PYRE_VIBFM Orotate phosphoribosyltransferase OS=Vibrio fischeri (strain MJ11) GN=pyrE PE=3 SV=1 6 231 8.0E-52
sp|Q6LVN7|PYRE_PHOPR Orotate phosphoribosyltransferase OS=Photobacterium profundum GN=pyrE PE=3 SV=1 6 231 9.0E-52
sp|Q3BNB6|PYRE_XANC5 Orotate phosphoribosyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pyrE PE=3 SV=1 6 231 1.0E-51
sp|Q48AN2|PYRE_COLP3 Orotate phosphoribosyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pyrE PE=3 SV=1 6 231 1.0E-51
sp|Q8DDX5|PYRE_VIBVU Orotate phosphoribosyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=pyrE PE=3 SV=1 6 231 1.0E-51
sp|B5BI16|PYRE_SALPK Orotate phosphoribosyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=pyrE PE=3 SV=1 9 231 1.0E-51
sp|Q5PC26|PYRE_SALPA Orotate phosphoribosyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pyrE PE=3 SV=1 9 231 1.0E-51
sp|Q87T92|PYRE_VIBPA Orotate phosphoribosyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pyrE PE=3 SV=1 6 231 2.0E-51
sp|Q8E9L5|PYRE_SHEON Orotate phosphoribosyltransferase OS=Shewanella oneidensis (strain MR-1) GN=pyrE PE=3 SV=1 6 231 2.0E-51
sp|Q2P898|PYRE_XANOM Orotate phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pyrE PE=3 SV=1 6 209 2.0E-51
sp|Q9KVD5|PYRE_VIBCH Orotate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pyrE PE=1 SV=2 6 231 3.0E-51
sp|B2UD27|PYRE_RALPJ Orotate phosphoribosyltransferase OS=Ralstonia pickettii (strain 12J) GN=pyrE PE=3 SV=1 4 231 4.0E-51
sp|B7VHJ8|PYRE_VIBTL Orotate phosphoribosyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=pyrE PE=3 SV=1 6 231 4.0E-51
sp|Q8Z2H5|PYRE_SALTI Orotate phosphoribosyltransferase OS=Salmonella typhi GN=pyrE PE=3 SV=3 9 231 4.0E-51
sp|P50587|PYRE_PSEAE Orotate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pyrE PE=3 SV=2 6 231 5.0E-51
sp|Q02E31|PYRE_PSEAB Orotate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pyrE PE=3 SV=1 6 231 5.0E-51
sp|B7V5M2|PYRE_PSEA8 Orotate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=pyrE PE=3 SV=1 6 210 5.0E-51
sp|C5B9D0|PYRE_EDWI9 Orotate phosphoribosyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=pyrE PE=3 SV=1 6 231 7.0E-51
sp|C1D6F5|PYRE_LARHH Orotate phosphoribosyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=pyrE PE=3 SV=1 6 231 7.0E-51
sp|Q8PFS5|PYRE_XANAC Orotate phosphoribosyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pyrE PE=3 SV=1 6 231 8.0E-51
sp|Q7VKV3|PYRE_HAEDU Orotate phosphoribosyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pyrE PE=3 SV=1 6 231 8.0E-51
sp|C1DI51|PYRE_AZOVD Orotate phosphoribosyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pyrE PE=3 SV=1 6 231 1.0E-50
sp|Q8Y342|PYRE_RALSO Orotate phosphoribosyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=pyrE PE=3 SV=2 4 231 2.0E-50
sp|A9I0G7|PYRE_BORPD Orotate phosphoribosyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pyrE PE=3 SV=1 12 231 3.0E-50
sp|Q21EF2|PYRE_SACD2 Orotate phosphoribosyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pyrE PE=3 SV=1 6 231 4.0E-50
sp|Q8P469|PYRE_XANCP Orotate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pyrE PE=3 SV=1 6 209 7.0E-50
sp|B0RXL2|PYRE_XANCB Orotate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=pyrE PE=3 SV=1 6 209 7.0E-50
sp|Q4UPQ3|PYRE_XANC8 Orotate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pyrE PE=3 SV=1 6 209 7.0E-50
sp|A6VSX4|PYRE_MARMS Orotate phosphoribosyltransferase OS=Marinomonas sp. (strain MWYL1) GN=pyrE PE=3 SV=1 9 231 1.0E-49
sp|P43855|PYRE_HAEIN Orotate phosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pyrE PE=1 SV=1 6 213 1.0E-49
sp|A5UAL7|PYRE_HAEIE Orotate phosphoribosyltransferase OS=Haemophilus influenzae (strain PittEE) GN=pyrE PE=3 SV=1 6 213 1.0E-49
sp|A6VLF2|PYRE_ACTSZ Orotate phosphoribosyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pyrE PE=3 SV=1 6 213 1.0E-49
sp|A5UG90|PYRE_HAEIG Orotate phosphoribosyltransferase OS=Haemophilus influenzae (strain PittGG) GN=pyrE PE=3 SV=1 6 213 1.0E-49
sp|Q4QNR7|PYRE_HAEI8 Orotate phosphoribosyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=pyrE PE=3 SV=1 6 213 1.0E-49
sp|B1J4L6|PYRE_PSEPW Orotate phosphoribosyltransferase OS=Pseudomonas putida (strain W619) GN=pyrE PE=3 SV=1 9 231 1.0E-49
sp|Q1I2T8|PYRE_PSEE4 Orotate phosphoribosyltransferase OS=Pseudomonas entomophila (strain L48) GN=pyrE PE=3 SV=1 9 231 1.0E-49
sp|C3K476|PYRE_PSEFS Orotate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=pyrE PE=3 SV=1 6 213 1.0E-49
sp|Q3IJI1|PYRE_PSEHT Orotate phosphoribosyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pyrE PE=3 SV=1 6 231 3.0E-49
sp|A1VIL5|PYRE_POLNA Orotate phosphoribosyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=pyrE PE=3 SV=1 11 231 3.0E-49
sp|B8GTF1|PYRE_THISH Orotate phosphoribosyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=pyrE PE=3 SV=1 6 231 4.0E-49
sp|Q4K3R9|PYRE_PSEF5 Orotate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pyrE PE=3 SV=1 9 231 4.0E-49
sp|Q88C92|PYRE_PSEPK Orotate phosphoribosyltransferase OS=Pseudomonas putida (strain KT2440) GN=pyrE PE=3 SV=1 9 231 7.0E-49
sp|B0KQ92|PYRE_PSEPG Orotate phosphoribosyltransferase OS=Pseudomonas putida (strain GB-1) GN=pyrE PE=3 SV=1 9 231 7.0E-49
sp|A5WB07|PYRE_PSEP1 Orotate phosphoribosyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pyrE PE=3 SV=1 9 231 7.0E-49
sp|Q8VR31|PYRE_METCA Orotate phosphoribosyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=pyrE PE=3 SV=2 6 231 4.0E-48
sp|A2SBW1|PYRE_METPP Orotate phosphoribosyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=pyrE PE=3 SV=1 11 231 5.0E-48
sp|Q820K1|PYRE_NITEU Orotate phosphoribosyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=pyrE PE=3 SV=1 6 209 1.0E-47
sp|Q3K4M3|PYRE_PSEPF Orotate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pyrE PE=3 SV=1 9 226 3.0E-47
sp|Q7NQ92|PYRE_CHRVO Orotate phosphoribosyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pyrE PE=3 SV=1 6 235 5.0E-47
sp|Q9CJW4|PYRE_PASMU Orotate phosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=pyrE PE=3 SV=1 6 209 6.0E-47
sp|A5EY64|PYRE_DICNV Orotate phosphoribosyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=pyrE PE=3 SV=1 6 231 7.0E-47
sp|B3PG74|PYRE_CELJU Orotate phosphoribosyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=pyrE PE=3 SV=1 6 231 1.0E-46
sp|P0CS95|PYRE_CRYNJ Orotate phosphoribosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=URA5 PE=3 SV=1 1 231 2.0E-46
sp|P0CQ41|PYRE_CRYNB Orotate phosphoribosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=URA5 PE=3 SV=1 1 231 2.0E-46
sp|A1AXP4|PYRE_RUTMC Orotate phosphoribosyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=pyrE PE=3 SV=1 6 231 2.0E-46
sp|J9VQB3|PYRE_CRYNH Orotate phosphoribosyltransferase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=URA5 PE=3 SV=1 1 231 3.0E-46
sp|A4T0F4|PYRE_POLSQ Orotate phosphoribosyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=pyrE PE=3 SV=1 12 231 3.0E-46
sp|Q5ZW83|PYRE_LEGPH Orotate phosphoribosyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=pyrE PE=3 SV=1 10 233 1.0E-45
sp|A5IBA2|PYRE_LEGPC Orotate phosphoribosyltransferase OS=Legionella pneumophila (strain Corby) GN=pyrE PE=3 SV=1 10 233 1.0E-45
sp|Q5X5W4|PYRE_LEGPA Orotate phosphoribosyltransferase OS=Legionella pneumophila (strain Paris) GN=pyrE PE=3 SV=1 10 233 1.0E-45
sp|Q5WX86|PYRE_LEGPL Orotate phosphoribosyltransferase OS=Legionella pneumophila (strain Lens) GN=pyrE PE=3 SV=1 10 233 1.0E-45
sp|C5BLH1|PYRE_TERTT Orotate phosphoribosyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pyrE PE=3 SV=1 9 231 2.0E-45
sp|A1KS25|PYRE_NEIMF Orotate phosphoribosyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=pyrE PE=3 SV=1 6 231 2.0E-44
sp|P65915|PYRE_NEIMB Orotate phosphoribosyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pyrE PE=3 SV=1 6 231 2.0E-44
sp|P65914|PYRE_NEIMA Orotate phosphoribosyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pyrE PE=3 SV=1 6 231 2.0E-44
sp|A9M1F6|PYRE_NEIM0 Orotate phosphoribosyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pyrE PE=3 SV=1 6 231 2.0E-44
sp|B3DS55|PYRE_BIFLD Orotate phosphoribosyltransferase OS=Bifidobacterium longum (strain DJO10A) GN=pyrE PE=3 SV=1 12 233 5.0E-44
sp|B4RNV9|PYRE_NEIG2 Orotate phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pyrE PE=3 SV=1 6 231 7.0E-44
sp|B8D880|PYRE_BUCAT Orotate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=pyrE PE=3 SV=1 8 231 9.0E-44
sp|P57622|PYRE_BUCAI Orotate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pyrE PE=3 SV=1 8 231 9.0E-44
sp|B8D8C3|PYRE_BUCA5 Orotate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=pyrE PE=3 SV=1 8 231 9.0E-44
sp|Q5FAK5|PYRE_NEIG1 Orotate phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pyrE PE=3 SV=1 6 231 1.0E-43
sp|Q8G661|PYRE_BIFLO Orotate phosphoribosyltransferase OS=Bifidobacterium longum (strain NCC 2705) GN=pyrE PE=3 SV=1 12 233 2.0E-43
sp|B7GRU8|PYRE_BIFLS Orotate phosphoribosyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=pyrE PE=3 SV=1 12 233 2.0E-43
sp|A1A1G3|PYRE_BIFAA Orotate phosphoribosyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=pyrE PE=3 SV=1 13 219 1.0E-41
sp|B8DUJ6|PYRE_BIFA0 Orotate phosphoribosyltransferase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=pyrE PE=3 SV=1 13 209 2.0E-41
sp|B1XSI4|PYRE_POLNS Orotate phosphoribosyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=pyrE PE=3 SV=1 12 231 7.0E-39
sp|C4K3W9|PYRE_HAMD5 Orotate phosphoribosyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=pyrE PE=3 SV=1 6 210 8.0E-39
sp|P59575|PYRE_BUCBP Orotate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=pyrE PE=3 SV=1 6 210 4.0E-36
sp|A9KKR4|PYRE_CLOPH Orotate phosphoribosyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=pyrE PE=3 SV=1 6 214 8.0E-36
sp|Q97N11|PYRE_CLOAB Orotate phosphoribosyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pyrE PE=3 SV=1 6 231 2.0E-35
sp|B2UW87|PYRE_CLOBA Orotate phosphoribosyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pyrE PE=3 SV=1 6 233 4.0E-35
sp|B2TNF7|PYRE_CLOBB Orotate phosphoribosyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pyrE PE=3 SV=1 6 233 1.0E-34
sp|A6LS60|PYRE_CLOB8 Orotate phosphoribosyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pyrE PE=3 SV=1 6 233 2.0E-34
sp|C4ZF78|PYRE_EUBR3 Orotate phosphoribosyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=pyrE PE=3 SV=1 6 231 5.0E-33
sp|Q8ZTG3|PYRE_PYRAE Orotate phosphoribosyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pyrE PE=3 SV=2 13 233 5.0E-17
sp|A1RRV2|PYRE_PYRIL Orotate phosphoribosyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=pyrE PE=3 SV=1 21 169 8.0E-17
sp|Q970X1|PYRE_SULTO Orotate phosphoribosyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pyrE PE=3 SV=1 12 230 1.0E-15
sp|A4WLH7|PYRE_PYRAR Orotate phosphoribosyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pyrE PE=3 SV=1 13 169 5.0E-15
sp|O58855|PYRE_PYRHO Orotate phosphoribosyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pyrE PE=3 SV=1 10 171 2.0E-14
sp|P0CL79|PYRE_PYRAB Orotate phosphoribosyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pyrE PE=3 SV=1 10 171 3.0E-14
sp|A3MX27|PYRE_PYRCJ Orotate phosphoribosyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pyrE PE=3 SV=1 14 233 5.0E-14
sp|Q5JHF4|PYRE_THEKO Orotate phosphoribosyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pyrE PE=3 SV=1 6 171 2.0E-13
sp|P0CL78|PYRE_PYRAY Orotate phosphoribosyltransferase OS=Pyrococcus abyssi GN=pyrE PE=3 SV=1 10 171 4.0E-13
sp|A3CU84|PYRE_METMJ Orotate phosphoribosyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pyrE PE=3 SV=1 18 169 4.0E-13
sp|P58861|PYRE_PYRFU Orotate phosphoribosyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pyrE PE=3 SV=1 10 171 4.0E-13
sp|C5A1Y3|PYRE_THEGJ Orotate phosphoribosyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pyrE PE=3 SV=1 8 171 7.0E-13
sp|Q5R514|UMPS_PONAB Uridine 5'-monophosphate synthase OS=Pongo abelii GN=UMPS PE=2 SV=1 23 169 5.0E-12
sp|P11172|UMPS_HUMAN Uridine 5'-monophosphate synthase OS=Homo sapiens GN=UMPS PE=1 SV=1 23 169 6.0E-12
sp|Q9HNG2|PYRE_HALSA Orotate phosphoribosyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pyrE PE=3 SV=1 23 171 7.0E-12
sp|A2SQ87|PYRE_METLZ Orotate phosphoribosyltransferase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pyrE PE=3 SV=1 23 183 1.0E-11
sp|O08359|PYRE_SULAC Orotate phosphoribosyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pyrE PE=3 SV=1 25 171 1.0E-11
sp|P13439|UMPS_MOUSE Uridine 5'-monophosphate synthase OS=Mus musculus GN=Umps PE=1 SV=3 19 169 4.0E-11
sp|Q2NFI3|PYRE_METST Orotate phosphoribosyltransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pyrE PE=3 SV=1 6 171 4.0E-11
sp|O27888|PYRE_METTH Orotate phosphoribosyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pyrE PE=3 SV=1 1 207 2.0E-10
sp|D4GZW2|PYRE_HALVD Orotate phosphoribosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pyrE2 PE=3 SV=1 23 214 8.0E-10
sp|Q97CT9|PYRE_THEVO Orotate phosphoribosyltransferase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pyrE PE=3 SV=1 18 193 9.0E-10
sp|Q8Q0J4|PYRE_METMA Orotate phosphoribosyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pyrE PE=3 SV=1 4 210 1.0E-09
sp|Q42586|UMPS_ARATH Uridine 5'-monophosphate synthase OS=Arabidopsis thaliana GN=PYRE-F PE=2 SV=2 21 171 2.0E-09
sp|P58860|PYRE_METKA Orotate phosphoribosyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pyrE PE=3 SV=1 21 143 3.0E-09
sp|P31754|UMPS_BOVIN Uridine 5'-monophosphate synthase OS=Bos taurus GN=UMPS PE=2 SV=1 19 169 5.0E-09
sp|Q9UX09|PYRE_SULSO Orotate phosphoribosyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pyrE PE=3 SV=1 12 171 1.0E-08
sp|Q42942|UMPS_TOBAC Uridine 5'-monophosphate synthase (Fragment) OS=Nicotiana tabacum GN=PYR5-6 PE=2 SV=1 19 169 1.0E-08
sp|Q25566|UMPS_NAEGR Uridine 5'-monophosphate synthase OS=Naegleria gruberi GN=UMP PE=3 SV=1 10 178 1.0E-08
sp|A0RY85|PYRE_CENSY Orotate phosphoribosyltransferase OS=Cenarchaeum symbiosum (strain A) GN=pyrE PE=3 SV=1 21 171 2.0E-08
sp|B5E302|PYRE_STRP4 Orotate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=pyrE PE=3 SV=1 63 184 2.0E-08
sp|Q8NKQ2|PYREL_HALVD PyrE-like protein OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pyrE1 PE=3 SV=1 58 170 2.0E-08
sp|P58859|PYRE_METAC Orotate phosphoribosyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pyrE PE=3 SV=1 4 179 3.0E-08
sp|Q6LX60|PYRE_METMP Orotate phosphoribosyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=pyrE PE=3 SV=1 1 171 4.0E-08
sp|Q58509|PYRE_METJA Orotate phosphoribosyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pyrE PE=3 SV=1 21 171 4.0E-08
sp|Q5M4H9|PYRE_STRT2 Orotate phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pyrE PE=3 SV=1 72 230 5.0E-08
sp|Q5LZW8|PYRE_STRT1 Orotate phosphoribosyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pyrE PE=3 SV=1 72 230 5.0E-08
sp|Q03KS5|PYRE_STRTD Orotate phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=pyrE PE=3 SV=1 72 230 5.0E-08
sp|P65918|PYRE_STRA5 Orotate phosphoribosyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pyrE PE=3 SV=1 72 229 5.0E-08
sp|P65917|PYRE_STRA3 Orotate phosphoribosyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pyrE PE=3 SV=1 72 229 5.0E-08
sp|A3DM49|PYRE_STAMF Orotate phosphoribosyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pyrE PE=3 SV=1 22 171 5.0E-08
sp|Q2FPQ2|PYRE_METHJ Orotate phosphoribosyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pyrE PE=3 SV=1 11 211 6.0E-08
sp|Q8DTV2|PYRE_STRMU Orotate phosphoribosyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pyrE PE=1 SV=1 54 182 7.0E-08
sp|Q8Y668|PYRE_LISMO Orotate phosphoribosyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pyrE PE=3 SV=1 58 229 7.0E-08
sp|A6U5N7|PYRE_SINMW Orotate phosphoribosyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=pyrE PE=3 SV=1 28 184 8.0E-08
sp|Q71YI5|PYRE_LISMF Orotate phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pyrE PE=3 SV=1 58 230 9.0E-08
sp|Q46F14|PYEL1_METBF PyrE-like protein 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A0547 PE=3 SV=1 33 169 9.0E-08
sp|Q18FD1|PYRE_HALWD Orotate phosphoribosyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pyrE PE=3 SV=1 23 171 1.0E-07
sp|A2C0A9|PYRE_PROM1 Orotate phosphoribosyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=pyrE PE=3 SV=1 24 171 1.0E-07
sp|Q92AH7|PYRE_LISIN Orotate phosphoribosyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pyrE PE=3 SV=1 58 173 1.0E-07
sp|Q92SC6|PYRE_RHIME Orotate phosphoribosyltransferase OS=Rhizobium meliloti (strain 1021) GN=pyrE PE=3 SV=1 28 184 1.0E-07
sp|P0CB78|PYRE_STRPN Orotate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pyrE PE=1 SV=1 63 184 1.0E-07
sp|Q3K146|PYRE_STRA1 Orotate phosphoribosyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pyrE PE=3 SV=1 72 229 1.0E-07
sp|Q8DQL5|PYRE_STRR6 Orotate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pyrE PE=3 SV=1 63 184 1.0E-07
sp|Q04LJ2|PYRE_STRP2 Orotate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pyrE PE=3 SV=1 63 184 1.0E-07
sp|Q3IT15|PYRE_NATPD Orotate phosphoribosyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pyrE PE=3 SV=1 10 157 2.0E-07
sp|Q9LDN2|UMPS1_ORYSJ Uridine 5'-monophosphate synthase OS=Oryza sativa subsp. japonica GN=UMPS1 PE=2 SV=1 23 157 2.0E-07
sp|Q49WY6|PYRE_STAS1 Orotate phosphoribosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pyrE PE=3 SV=1 72 164 2.0E-07
sp|A2RF04|PYRE_STRPG Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=pyrE PE=3 SV=1 54 184 3.0E-07
sp|P0DD69|PYRE_STRPQ Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pyrE PE=3 SV=1 54 184 3.0E-07
sp|Q1J728|PYRE_STRPF Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pyrE PE=3 SV=1 54 184 3.0E-07
sp|P65920|PYRE_STRP8 Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pyrE PE=3 SV=1 54 184 3.0E-07
sp|Q5XCK7|PYRE_STRP6 Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pyrE PE=3 SV=1 54 184 3.0E-07
sp|P0DD68|PYRE_STRP3 Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pyrE PE=3 SV=1 54 184 3.0E-07
sp|Q1JHA9|PYRE_STRPD Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pyrE PE=3 SV=1 54 184 3.0E-07
sp|C3MF81|PYRE_RHISN Orotate phosphoribosyltransferase OS=Rhizobium sp. (strain NGR234) GN=pyrE PE=3 SV=1 28 184 3.0E-07
sp|Q9A076|PYRE_STRP1 Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M1 GN=pyrE PE=1 SV=1 72 184 4.0E-07
sp|Q20WV6|PYRE_RHOPB Orotate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=pyrE PE=3 SV=1 26 171 4.0E-07
sp|A9GUD3|PYRE_SORC5 Orotate phosphoribosyltransferase OS=Sorangium cellulosum (strain So ce56) GN=pyrE PE=3 SV=1 74 209 5.0E-07
sp|Q0W6Q2|PYRE_METAR Orotate phosphoribosyltransferase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pyrE PE=3 SV=1 12 171 6.0E-07
sp|A7IAZ7|PYREL_METB6 PyrE-like protein OS=Methanoregula boonei (strain 6A8) GN=Mboo_2394 PE=3 SV=1 74 169 6.0E-07
sp|Q1JM64|PYRE_STRPC Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pyrE PE=3 SV=1 54 184 6.0E-07
sp|Q1JC80|PYRE_STRPB Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pyrE PE=3 SV=1 54 184 6.0E-07
sp|A8AXM7|PYRE_STRGC Orotate phosphoribosyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=pyrE PE=3 SV=1 72 184 8.0E-07
sp|Q3B095|PYRE_SYNS9 Orotate phosphoribosyltransferase OS=Synechococcus sp. (strain CC9902) GN=pyrE PE=3 SV=1 6 176 8.0E-07
sp|P09556|UMPS_DICDI Uridine 5'-monophosphate synthase OS=Dictyostelium discoideum GN=pyr56 PE=1 SV=2 23 171 9.0E-07
sp|Q89BL4|PYRE_BRADU Orotate phosphoribosyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pyrE PE=3 SV=2 26 171 9.0E-07
sp|B5ZNS6|PYRE_RHILW Orotate phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pyrE PE=3 SV=1 28 160 1.0E-06
sp|A3CN88|PYRE_STRSV Orotate phosphoribosyltransferase OS=Streptococcus sanguinis (strain SK36) GN=pyrE PE=3 SV=1 72 184 1.0E-06
sp|B9LUS0|PYREL_HALLT PyrE-like protein OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=Hlac_0798 PE=3 SV=1 47 169 1.0E-06
sp|Q9HM15|PYRE_THEAC Orotate phosphoribosyltransferase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pyrE PE=3 SV=1 21 183 2.0E-06
sp|Q8NM11|PYRE_CORGL Orotate phosphoribosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pyrE PE=1 SV=1 1 169 2.0E-06
sp|A4QHG9|PYRE_CORGB Orotate phosphoribosyltransferase OS=Corynebacterium glutamicum (strain R) GN=pyrE PE=3 SV=1 25 169 3.0E-06
sp|Q053K4|PYRE_LEPBL Orotate phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=pyrE PE=3 SV=1 28 171 3.0E-06
sp|Q6GHN0|PYRE_STAAR Orotate phosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=pyrE PE=3 SV=1 72 164 3.0E-06
sp|P99144|PYRE_STAAN Orotate phosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=pyrE PE=1 SV=1 72 164 3.0E-06
sp|P65916|PYRE_STAAM Orotate phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pyrE PE=3 SV=1 72 164 3.0E-06
sp|Q9CGM8|PYRE_LACLA Orotate phosphoribosyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pyrE PE=3 SV=1 72 164 3.0E-06
sp|Q02ZC9|PYRE_LACLS Orotate phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=pyrE PE=3 SV=1 72 164 3.0E-06
sp|Q48U09|PYRE_STRPM Orotate phosphoribosyltransferase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pyrE PE=3 SV=1 54 184 3.0E-06
sp|A2RLC0|PYRE_LACLM Orotate phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pyrE PE=3 SV=1 72 164 4.0E-06
sp|Q465U8|PYEL2_METBF PyrE-like protein 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A3471 PE=3 SV=1 33 169 4.0E-06
sp|Q04R73|PYRE_LEPBJ Orotate phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=pyrE PE=3 SV=1 28 171 4.0E-06
sp|Q55574|PYRE_SYNY3 Orotate phosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyrE PE=3 SV=1 11 171 6.0E-06
sp|Q2NCF5|PYRE_ERYLH Orotate phosphoribosyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=pyrE PE=3 SV=1 26 169 6.0E-06
sp|Q1MM09|PYRE_RHIL3 Orotate phosphoribosyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pyrE PE=3 SV=1 28 160 7.0E-06
sp|Q9RX68|PYRE_DEIRA Orotate phosphoribosyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pyrE PE=3 SV=1 21 172 7.0E-06
sp|Q2KCZ1|PYRE_RHIEC Orotate phosphoribosyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pyrE PE=3 SV=1 28 160 8.0E-06
sp|Q8NX25|PYRE_STAAW Orotate phosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=pyrE PE=3 SV=1 72 164 8.0E-06
sp|Q6GA08|PYRE_STAAS Orotate phosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=pyrE PE=3 SV=1 72 164 8.0E-06
sp|Q5HGM7|PYRE_STAAC Orotate phosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=pyrE PE=3 SV=1 72 164 8.0E-06
sp|Q8YM41|PYRE_NOSS1 Orotate phosphoribosyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pyrE PE=3 SV=1 24 171 8.0E-06
sp|B3Q0A6|PYRE_RHIE6 Orotate phosphoribosyltransferase OS=Rhizobium etli (strain CIAT 652) GN=pyrE PE=3 SV=1 28 160 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009116 nucleoside metabolic process Yes
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|836
MAPTQLPEYKREFLKAAIDGGVLKFGSFELKSKRISPYFFNAGEFHSARLAAAISAAFARTIVDARQHSGLDFDV
VFGPAYKGIPLCSAITVKIGELAPQLLDRISYSFDRKEAKDHGEGGNIVGAPLKGKKVLIVDDVITAGTAKRDAI
DKIRREGGVVAGIVVALDRMEKLPAADGDDSKPGPSAIGELRREYDIPILAILTLDDIIQGMDGFASADDIKRTQ
EYRQKYKATD*
Coding >Hirsu2|836
ATGGCTCCGACCCAATTGCCCGAGTACAAGCGAGAGTTCCTCAAGGCCGCCATCGATGGCGGCGTCCTCAAGTTT
GGCAGTTTTGAGCTCAAGTCCAAGAGGATATCGCCGTACTTCTTCAACGCCGGCGAGTTCCACAGCGCGCGCCTC
GCCGCGGCCATCTCCGCCGCCTTTGCCCGGACCATCGTCGATGCCCGCCAACACAGCGGCCTGGACTTTGACGTC
GTCTTCGGGCCCGCCTACAAGGGAATCCCCCTCTGCTCGGCCATCACGGTCAAGATCGGCGAATTGGCCCCTCAA
CTGCTCGACCGCATCTCCTACTCCTTCGACCGCAAGGAGGCCAAAGACCACGGCGAGGGCGGGAACATCGTCGGC
GCCCCGCTCAAGGGCAAGAAGGTCCTCATCGTTGACGATGTCATCACCGCCGGCACCGCAAAGAGGGACGCGATC
GACAAGATTCGAAGAGAGGGCGGCGTCGTGGCCGGTATAGTCGTCGCTCTCGACCGCATGGAAAAGCTTCCCGCC
GCCGACGGGGATGACTCCAAGCCGGGACCCAGCGCCATCGGCGAGCTCAGACGAGAGTATGACATTCCCATTCTG
GCCATCCTGACCTTGGATGATATCATCCAGGGCATGGACGGCTTCGCTTCTGCCGACGACATCAAGCGGACCCAG
GAGTATCGACAAAAGTACAAGGCAACCGACTAG
Transcript >Hirsu2|836
ATGGCTCCGACCCAATTGCCCGAGTACAAGCGAGAGTTCCTCAAGGCCGCCATCGATGGCGGCGTCCTCAAGTTT
GGCAGTTTTGAGCTCAAGTCCAAGAGGATATCGCCGTACTTCTTCAACGCCGGCGAGTTCCACAGCGCGCGCCTC
GCCGCGGCCATCTCCGCCGCCTTTGCCCGGACCATCGTCGATGCCCGCCAACACAGCGGCCTGGACTTTGACGTC
GTCTTCGGGCCCGCCTACAAGGGAATCCCCCTCTGCTCGGCCATCACGGTCAAGATCGGCGAATTGGCCCCTCAA
CTGCTCGACCGCATCTCCTACTCCTTCGACCGCAAGGAGGCCAAAGACCACGGCGAGGGCGGGAACATCGTCGGC
GCCCCGCTCAAGGGCAAGAAGGTCCTCATCGTTGACGATGTCATCACCGCCGGCACCGCAAAGAGGGACGCGATC
GACAAGATTCGAAGAGAGGGCGGCGTCGTGGCCGGTATAGTCGTCGCTCTCGACCGCATGGAAAAGCTTCCCGCC
GCCGACGGGGATGACTCCAAGCCGGGACCCAGCGCCATCGGCGAGCTCAGACGAGAGTATGACATTCCCATTCTG
GCCATCCTGACCTTGGATGATATCATCCAGGGCATGGACGGCTTCGCTTCTGCCGACGACATCAAGCGGACCCAG
GAGTATCGACAAAAGTACAAGGCAACCGACTAG
Gene >Hirsu2|836
ATGGCTCCGACCCAATTGCCCGAGTACAAGCGAGAGTTCCTCAAGGCCGCCATCGATGGCGGCGTCCTCAAGTTT
GGCAGTTTTGAGCTCAAGTCCAAGAGGATATCGCCGTACTTCTTCAACGCCGGCGAGTTCCACAGCGCGCGCCTC
GCCGCGGCCATCTCCGCCGCCTTTGCCCGGACCATCGTCGATGCCCGCCAACACAGCGGCCTGGACTTTGACGTC
GTCTTCGGGCCCGCCTACAAGGGAATCCCCCTCTGCTCGGCCATCACGGTCAAGATCGGCGAATTGGCCCCTCAA
CTGCTCGACCGCATCTCCTACTCCTTCGACCGCAAGGAGGCCAAAGACCACGGCGAGGGCGGGAACATCGTCGGC
GCCCCGCTCAAGGGCAAGAAGGTCCTCATCGTTGACGATGTCATCACCGCCGGCACCGCAAAGAGGGACGCGATC
GACAAGATTCGAAGAGAGGGCGGCGTCGTGGCCGGTATAGTCGTCGCTCTCGACCGCATGGAAAAGCTTCCCGCC
GCCGACGGGGATGACTCCAAGCCGGGACCCAGCGCCATCGGCGAGCTCAGACGAGAGTATGACATTCCCATTCTG
GCCATCCTGACCTTGGATGATATCATCCAGGGCATGGACGGCTTCGCTTCTGCCGACGACATCAAGCGGACCCAG
GAGTATCGACAAAAGTACAAGGCAACCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail