Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8359
Gene name
LocationContig_54:28013..29565
Strand-
Gene length (bp)1552
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00113 Enolase_C Enolase, C-terminal TIM barrel domain 1.4E-154 144 435
PF03952 Enolase_N Enolase, N-terminal domain 2.5E-57 3 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RV85|ENO_NEUCR Enolase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=emp-7 PE=3 SV=1 1 438 0.0E+00
sp|Q6RG04|ENO_CRYPA Enolase OS=Cryphonectria parasitica GN=ENO1 PE=3 SV=1 1 438 0.0E+00
sp|Q12560|ENO_ASPOR Enolase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=enoA PE=2 SV=1 1 438 0.0E+00
sp|Q96X30|ENO_ASPFU Enolase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=enoA PE=1 SV=3 1 438 0.0E+00
sp|Q5B135|ENO_EMENI Enolase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=enoA PE=1 SV=1 1 438 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RV85|ENO_NEUCR Enolase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=emp-7 PE=3 SV=1 1 438 0.0E+00
sp|Q6RG04|ENO_CRYPA Enolase OS=Cryphonectria parasitica GN=ENO1 PE=3 SV=1 1 438 0.0E+00
sp|Q12560|ENO_ASPOR Enolase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=enoA PE=2 SV=1 1 438 0.0E+00
sp|Q96X30|ENO_ASPFU Enolase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=enoA PE=1 SV=3 1 438 0.0E+00
sp|Q5B135|ENO_EMENI Enolase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=enoA PE=1 SV=1 1 438 0.0E+00
sp|Q9HDT3|ENO_ALTAL Enolase OS=Alternaria alternata GN=ENO PE=1 SV=2 1 438 0.0E+00
sp|Q76KF9|ENO_PENCH Enolase OS=Penicillium chrysogenum GN=enoA PE=2 SV=1 1 438 0.0E+00
sp|Q96X46|ENO_PENCI Enolase OS=Penicillium citrinum GN=enoA PE=1 SV=3 1 438 0.0E+00
sp|P42040|ENO_DAVTA Enolase OS=Davidiella tassiana GN=ENO PE=1 SV=2 1 438 0.0E+00
sp|Q6W3C0|ENO_TUBBO Enolase OS=Tuber borchii GN=eno-1 PE=1 SV=1 3 431 0.0E+00
sp|Q96VP4|ENO_COCLU Enolase OS=Cochliobolus lunatus PE=2 SV=1 1 438 0.0E+00
sp|Q6C1F3|ENO_YARLI Enolase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ENO PE=3 SV=1 1 433 0.0E+00
sp|Q6BI20|ENO2_DEBHA Enolase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ENO2 PE=3 SV=1 1 438 0.0E+00
sp|Q870B9|ENO_RHOMI Enolase OS=Rhodotorula mucilaginosa GN=ENO PE=1 SV=1 1 438 0.0E+00
sp|P30575|ENO1_CANAL Enolase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ENO1 PE=2 SV=1 4 438 0.0E+00
sp|P00924|ENO1_YEAST Enolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENO1 PE=1 SV=3 1 433 0.0E+00
sp|Q6BTB1|ENO1_DEBHA Enolase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ENO1 PE=3 SV=1 1 438 0.0E+00
sp|Q6FQY4|ENO2_CANGA Enolase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ENO2 PE=3 SV=1 1 438 0.0E+00
sp|Q70CP7|ENO_KLULA Enolase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ENO PE=3 SV=1 1 438 0.0E+00
sp|Q756H2|ENO_ASHGO Enolase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ENO PE=3 SV=1 1 438 0.0E+00
sp|P42894|ENO_NEOFR Enolase OS=Neocallimastix frontalis PE=3 SV=1 1 434 0.0E+00
sp|P00925|ENO2_YEAST Enolase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENO2 PE=1 SV=2 1 433 0.0E+00
sp|O74286|ENO_CUNEL Enolase (Fragment) OS=Cunninghamella elegans PE=2 SV=1 3 438 0.0E+00
sp|P40370|ENO11_SCHPO Enolase 1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eno101 PE=1 SV=2 1 436 0.0E+00
sp|Q27527|ENO_CAEEL Enolase OS=Caenorhabditis elegans GN=enol-1 PE=1 SV=3 1 433 0.0E+00
sp|P0CX11|ERR2_YEAST Enolase-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERR2 PE=3 SV=1 1 433 0.0E+00
sp|P0CX10|ERR1_YEAST Enolase-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERR1 PE=3 SV=1 1 433 0.0E+00
sp|P42222|ERR3_YEAST Enolase-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERR3 PE=3 SV=2 1 433 0.0E+00
sp|O02654|ENO_DORPE Enolase OS=Doryteuthis pealeii PE=2 SV=1 1 433 0.0E+00
sp|P51913|ENOA_CHICK Alpha-enolase OS=Gallus gallus GN=ENO1 PE=2 SV=2 1 433 0.0E+00
sp|Q27655|ENO_FASHE Enolase OS=Fasciola hepatica GN=ENO PE=2 SV=1 1 434 0.0E+00
sp|Q9W7L2|ENOA_SCEUN Alpha-enolase OS=Sceloporus undulatus PE=2 SV=3 1 433 0.0E+00
sp|Q9PVK2|ENOA_ALLMI Alpha-enolase OS=Alligator mississippiensis PE=2 SV=3 1 433 0.0E+00
sp|P17183|ENOG_MOUSE Gamma-enolase OS=Mus musculus GN=Eno2 PE=1 SV=2 1 433 0.0E+00
sp|P09104|ENOG_HUMAN Gamma-enolase OS=Homo sapiens GN=ENO2 PE=1 SV=3 1 433 0.0E+00
sp|O57391|ENOG_CHICK Gamma-enolase OS=Gallus gallus GN=ENO2 PE=2 SV=1 1 433 0.0E+00
sp|P07323|ENOG_RAT Gamma-enolase OS=Rattus norvegicus GN=Eno2 PE=1 SV=2 1 433 0.0E+00
sp|P19140|ENOA_ANAPL Alpha-enolase OS=Anas platyrhynchos GN=ENO1 PE=2 SV=2 1 433 0.0E+00
sp|P21550|ENOB_MOUSE Beta-enolase OS=Mus musculus GN=Eno3 PE=1 SV=3 1 433 0.0E+00
sp|P13929|ENOB_HUMAN Beta-enolase OS=Homo sapiens GN=ENO3 PE=1 SV=5 1 433 0.0E+00
sp|P15429|ENOB_RAT Beta-enolase OS=Rattus norvegicus GN=Eno3 PE=1 SV=3 1 433 0.0E+00
sp|Q9XSJ4|ENOA_BOVIN Alpha-enolase OS=Bos taurus GN=ENO1 PE=1 SV=4 1 433 0.0E+00
sp|Q9W7L1|ENOA_TRASC Alpha-enolase OS=Trachemys scripta PE=2 SV=3 1 433 0.0E+00
sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens GN=ENO1 PE=1 SV=2 1 433 0.0E+00
sp|P25704|ENOB_RABIT Beta-enolase OS=Oryctolagus cuniculus GN=ENO3 PE=1 SV=4 1 433 0.0E+00
sp|Q4R5L2|ENOA_MACFA Alpha-enolase OS=Macaca fascicularis GN=ENO1 PE=2 SV=1 1 433 0.0E+00
sp|Q3ZC09|ENOB_BOVIN Beta-enolase OS=Bos taurus GN=ENO3 PE=2 SV=1 1 433 0.0E+00
sp|Q5R6Y1|ENOA_PONAB Alpha-enolase OS=Pongo abelii GN=ENO1 PE=2 SV=1 1 433 0.0E+00
sp|Q1KYT0|ENOB_PIG Beta-enolase OS=Sus scrofa GN=ENO3 PE=2 SV=1 1 433 0.0E+00
sp|P17182|ENOA_MOUSE Alpha-enolase OS=Mus musculus GN=Eno1 PE=1 SV=3 1 433 0.0E+00
sp|P04764|ENOA_RAT Alpha-enolase OS=Rattus norvegicus GN=Eno1 PE=1 SV=4 1 433 0.0E+00
sp|B5DGQ7|ENOB_SALSA Beta-enolase OS=Salmo salar GN=ENO3 PE=1 SV=1 1 433 0.0E+00
sp|P08734|ENOA_XENLA Alpha-enolase OS=Xenopus laevis GN=eno1 PE=2 SV=2 1 436 0.0E+00
sp|Q9W7L0|ENOA_PYTRG Alpha-enolase OS=Python regius PE=2 SV=3 1 433 0.0E+00
sp|Q6FTW6|ENO1_CANGA Enolase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ENO1 PE=3 SV=1 1 434 0.0E+00
sp|I0J1J1|ENOA_THUAL Alpha-enolase OS=Thunnus albacares GN=ENO1 PE=1 SV=1 1 436 0.0E+00
sp|P56252|ENO_HOMGA Enolase OS=Homarus gammarus PE=1 SV=1 2 433 0.0E+00
sp|P33676|ENO_SCHJA Enolase OS=Schistosoma japonicum GN=ENO PE=2 SV=1 1 433 0.0E+00
sp|P15007|ENO_DROME Enolase OS=Drosophila melanogaster GN=Eno PE=1 SV=2 1 434 0.0E+00
sp|Q27877|ENO_SCHMA Enolase OS=Schistosoma mansoni GN=ENO PE=2 SV=1 1 433 0.0E+00
sp|P07322|ENOB_CHICK Beta-enolase OS=Gallus gallus GN=ENO3 PE=1 SV=3 1 433 0.0E+00
sp|Q9C9C4|ENO1_ARATH Enolase 1, chloroplastic OS=Arabidopsis thaliana GN=ENO1 PE=1 SV=1 3 433 0.0E+00
sp|Q8IJN7|ENO_PLAF7 Enolase OS=Plasmodium falciparum (isolate 3D7) GN=ENO PE=3 SV=1 3 437 0.0E+00
sp|Q27727|ENO_PLAFA Enolase OS=Plasmodium falciparum GN=ENO PE=3 SV=1 3 437 0.0E+00
sp|Q8NKC2|ENO12_SCHPO Enolase 1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eno102 PE=3 SV=2 3 430 0.0E+00
sp|Q9UAL5|ENO_PLAFG Enolase OS=Plasmodium falciparum (isolate FCR-3 / Gambia) GN=ENO PE=2 SV=1 3 437 0.0E+00
sp|P51555|ENO1_ENTHI Enolase 1 OS=Entamoeba histolytica GN=ENL-1 PE=1 SV=1 1 435 0.0E+00
sp|P26300|ENO_SOLLC Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1 3 436 0.0E+00
sp|Q43130|ENO_MESCR Enolase OS=Mesembryanthemum crystallinum GN=PGH1 PE=2 SV=1 1 436 0.0E+00
sp|Q42971|ENO_ORYSJ Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE=1 SV=2 3 436 0.0E+00
sp|P42897|ENO_ALLMI Enolase (Fragment) OS=Alligator mississippiensis PE=2 SV=1 23 421 0.0E+00
sp|P42896|ENO_RICCO Enolase OS=Ricinus communis PE=2 SV=1 1 436 0.0E+00
sp|P42895|ENO2_MAIZE Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1 3 436 0.0E+00
sp|Q9LEJ0|ENO1_HEVBR Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1 1 436 0.0E+00
sp|P25696|ENO2_ARATH Bifunctional enolase 2/transcriptional activator OS=Arabidopsis thaliana GN=ENO2 PE=1 SV=1 3 436 1.0E-180
sp|Q967Y8|ENO_EIMTE Enolase OS=Eimeria tenella GN=ENO PE=2 SV=1 1 437 5.0E-180
sp|P26301|ENO1_MAIZE Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1 1 436 8.0E-179
sp|Q9LEI9|ENO2_HEVBR Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1 1 436 2.0E-178
sp|Q7RA60|ENO_PLAYO Enolase OS=Plasmodium yoelii yoelii GN=ENO PE=3 SV=2 1 437 2.0E-178
sp|Q9BPL7|ENO2_TOXGO Enolase 2 OS=Toxoplasma gondii GN=ENO2 PE=1 SV=1 1 433 3.0E-178
sp|Q54RK5|ENOA_DICDI Enolase A OS=Dictyostelium discoideum GN=enoA PE=3 SV=1 3 434 1.0E-177
sp|Q9U615|ENO_MASBA Enolase OS=Mastigamoeba balamuthi GN=ENOL PE=2 SV=1 3 428 1.0E-176
sp|Q43321|ENO_ALNGL Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1 3 436 4.0E-170
sp|Q9UAE6|ENO1_TOXGO Enolase 1 OS=Toxoplasma gondii GN=ENO1 PE=1 SV=1 1 433 2.0E-169
sp|P31683|ENO_CHLRE Enolase (Fragment) OS=Chlamydomonas reinhardtii GN=ENO PE=2 SV=1 62 433 4.0E-165
sp|Q55F83|ENOB_DICDI Enolase B OS=Dictyostelium discoideum GN=enoB PE=3 SV=1 1 432 4.0E-160
sp|O59605|ENO_PYRHO Enolase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=eno PE=3 SV=1 3 434 1.0E-153
sp|Q8U477|ENO_PYRFU Enolase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=eno PE=3 SV=1 3 434 4.0E-153
sp|Q9ZW34|ENO3_ARATH Cytosolic enolase 3 OS=Arabidopsis thaliana GN=ENO3 PE=1 SV=1 3 433 7.0E-151
sp|Q60173|ENO_METJA Enolase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=eno PE=1 SV=2 3 433 7.0E-150
sp|C5A2S7|ENO_THEGJ Enolase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=eno PE=3 SV=1 3 433 2.0E-148
sp|A6UUM2|ENO_META3 Enolase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=eno PE=3 SV=2 3 433 3.0E-148
sp|Q5JEV6|ENO_THEKO Enolase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=eno PE=3 SV=1 3 433 4.0E-147
sp|B6YUB8|ENO_THEON Enolase OS=Thermococcus onnurineus (strain NA1) GN=eno PE=3 SV=1 3 433 5.0E-147
sp|A1R485|ENO_ARTAT Enolase OS=Arthrobacter aurescens (strain TC1) GN=eno PE=3 SV=1 3 429 4.0E-145
sp|C5D7M1|ENO_GEOSW Enolase OS=Geobacillus sp. (strain WCH70) GN=eno PE=3 SV=1 2 429 9.0E-145
sp|Q5KVE7|ENO_GEOKA Enolase OS=Geobacillus kaustophilus (strain HTA426) GN=eno PE=3 SV=1 2 438 2.0E-144
sp|Q9UXZ0|ENO_PYRAB Enolase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=eno PE=3 SV=2 3 434 1.0E-143
sp|A6US08|ENO_METVS Enolase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=eno PE=3 SV=2 3 433 1.0E-143
sp|B3QQT2|ENO_CHLP8 Enolase OS=Chlorobaculum parvum (strain NCIB 8327) GN=eno PE=3 SV=1 3 433 1.0E-143
sp|A4ISP4|ENO_GEOTN Enolase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=eno PE=3 SV=1 2 438 1.0E-143
sp|Q6HBF3|ENO_BACHK Enolase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=eno PE=3 SV=1 3 429 2.0E-143
sp|C1EZA0|ENO_BACC3 Enolase OS=Bacillus cereus (strain 03BB102) GN=eno PE=3 SV=1 3 429 2.0E-143
sp|B7JFG3|ENO_BACC0 Enolase OS=Bacillus cereus (strain AH820) GN=eno PE=3 SV=1 3 429 2.0E-143
sp|Q81X78|ENO_BACAN Enolase OS=Bacillus anthracis GN=eno PE=3 SV=1 3 429 2.0E-143
sp|A0RKS3|ENO_BACAH Enolase OS=Bacillus thuringiensis (strain Al Hakam) GN=eno PE=3 SV=1 3 429 2.0E-143
sp|C3LDI0|ENO_BACAC Enolase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=eno PE=3 SV=1 3 429 2.0E-143
sp|C3P0A3|ENO_BACAA Enolase OS=Bacillus anthracis (strain A0248) GN=eno PE=3 SV=1 3 429 2.0E-143
sp|Q631M2|ENO_BACCZ Enolase OS=Bacillus cereus (strain ZK / E33L) GN=eno PE=3 SV=1 3 429 2.0E-143
sp|Q97L52|ENO_CLOAB Enolase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=eno PE=3 SV=1 3 431 3.0E-143
sp|A9VQ48|ENO_BACWK Enolase OS=Bacillus weihenstephanensis (strain KBAB4) GN=eno PE=3 SV=1 3 429 3.0E-143
sp|B7IFN4|ENO_THEAB Enolase OS=Thermosipho africanus (strain TCF52B) GN=eno PE=3 SV=1 1 429 4.0E-143
sp|Q3ATQ5|ENO_CHLCH Enolase OS=Chlorobium chlorochromatii (strain CaD3) GN=eno PE=3 SV=1 3 429 1.0E-142
sp|Q8KG25|ENO2_CHLTE Enolase 2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=eno2 PE=3 SV=1 3 433 2.0E-142
sp|Q67SV9|ENO_SYMTH Enolase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=eno PE=3 SV=1 3 431 3.0E-142
sp|B4S487|ENO_PROA2 Enolase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=eno PE=3 SV=1 3 433 4.0E-142
sp|Q1B439|ENO_MYCSS Enolase OS=Mycobacterium sp. (strain MCS) GN=eno PE=3 SV=1 3 429 6.0E-142
sp|A1UL09|ENO_MYCSK Enolase OS=Mycobacterium sp. (strain KMS) GN=eno PE=3 SV=1 3 429 6.0E-142
sp|A3Q5F7|ENO_MYCSJ Enolase OS=Mycobacterium sp. (strain JLS) GN=eno PE=3 SV=1 3 429 6.0E-142
sp|B3QXY4|ENO_CHLT3 Enolase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=eno PE=3 SV=1 3 427 9.0E-142
sp|A5N2N5|ENO_CLOK5 Enolase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=eno PE=3 SV=1 3 431 1.0E-141
sp|B9E6B1|ENO_CLOK1 Enolase OS=Clostridium kluyveri (strain NBRC 12016) GN=eno PE=3 SV=1 3 431 1.0E-141
sp|A4F804|ENO_SACEN Enolase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eno PE=3 SV=1 3 429 2.0E-141
sp|B4SGB2|ENO_PELPB Enolase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=eno PE=3 SV=1 3 438 2.0E-141
sp|A7NFI9|ENO_ROSCS Enolase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=eno PE=3 SV=1 3 435 5.0E-141
sp|Q3B1G7|ENO_CHLL7 Enolase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=eno PE=3 SV=1 3 433 5.0E-141
sp|A4SGL6|ENO_CHLPM Enolase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=eno PE=3 SV=1 3 433 6.0E-141
sp|C5C093|ENO_BEUC1 Enolase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=eno PE=3 SV=1 1 429 6.0E-141
sp|A7GUR7|ENO_BACCN Enolase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=eno PE=3 SV=1 3 429 7.0E-141
sp|Q468E2|ENO_METBF Enolase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=eno PE=3 SV=1 3 427 7.0E-141
sp|Q2RT60|ENO_RHORT Enolase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=eno PE=3 SV=1 3 434 8.0E-141
sp|Q1J2H6|ENO_DEIGD Enolase OS=Deinococcus geothermalis (strain DSM 11300) GN=eno PE=3 SV=1 1 429 1.0E-140
sp|B0K882|ENO_THEP3 Enolase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=eno PE=3 SV=1 2 431 1.0E-140
sp|B8HEU5|ENO_ARTCA Enolase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=eno PE=3 SV=1 3 429 2.0E-140
sp|Q8PT81|ENO_METMA Enolase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eno PE=3 SV=1 3 427 2.0E-140
sp|Q12VE5|ENO_METBU Enolase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=eno PE=3 SV=1 3 427 2.0E-140
sp|Q8NRS1|ENO_CORGL Enolase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=eno PE=3 SV=1 3 429 5.0E-140
sp|A4QCV0|ENO_CORGB Enolase OS=Corynebacterium glutamicum (strain R) GN=eno PE=3 SV=1 3 429 5.0E-140
sp|A5V1W0|ENO_ROSS1 Enolase OS=Roseiflexus sp. (strain RS-1) GN=eno PE=3 SV=1 3 433 7.0E-140
sp|C3PFA7|ENO_CORA7 Enolase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=eno PE=3 SV=1 3 429 7.0E-140
sp|E6ER18|ENO_ENTFT Enolase OS=Enterococcus faecalis (strain TX4000 / JH2-2) GN=eno PE=1 SV=1 3 429 9.0E-140
sp|P0DM31|ENO_ENTFA Enolase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=eno PE=3 SV=1 3 429 9.0E-140
sp|A6LJF0|ENO_THEM4 Enolase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=eno PE=3 SV=1 1 429 1.0E-139
sp|Q5YQ30|ENO_NOCFA Enolase OS=Nocardia farcinica (strain IFM 10152) GN=eno PE=3 SV=1 3 429 1.0E-139
sp|Q3AFC8|ENO_CARHZ Enolase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=eno PE=3 SV=1 3 429 1.0E-139
sp|C1FQW6|ENO_CLOBJ Enolase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=eno PE=3 SV=1 3 429 1.0E-139
sp|A0JU21|ENO_ARTS2 Enolase OS=Arthrobacter sp. (strain FB24) GN=eno PE=3 SV=1 3 429 1.0E-139
sp|Q6NI61|ENO_CORDI Enolase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=eno PE=3 SV=1 3 429 2.0E-139
sp|Q4JU51|ENO_CORJK Enolase OS=Corynebacterium jeikeium (strain K411) GN=eno PE=3 SV=1 3 429 2.0E-139
sp|Q6ADR6|ENO_LEIXX Enolase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=eno PE=3 SV=1 2 429 2.0E-139
sp|Q8TQ79|ENO_METAC Enolase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eno PE=3 SV=1 3 427 3.0E-139
sp|Q8GR70|ENO_ENTHR Enolase OS=Enterococcus hirae GN=eno PE=1 SV=1 3 429 3.0E-139
sp|A0R3B8|ENO_MYCS2 Enolase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=eno PE=1 SV=1 3 429 3.0E-139
sp|B0K6X6|ENO_THEPX Enolase OS=Thermoanaerobacter sp. (strain X514) GN=eno PE=3 SV=1 2 431 4.0E-139
sp|A5IIQ6|ENO_THEP1 Enolase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=eno PE=3 SV=1 3 429 5.0E-139
sp|P42848|ENO_THEMA Enolase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=eno PE=1 SV=2 3 429 5.0E-139
sp|A6LR09|ENO_CLOB8 Enolase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=eno PE=3 SV=1 1 435 5.0E-139
sp|C4L5H4|ENO_EXISA Enolase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=eno PE=3 SV=1 3 429 5.0E-139
sp|A0L7X8|ENO_MAGMM Enolase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=eno PE=3 SV=1 2 429 7.0E-139
sp|A6TU30|ENO_ALKMQ Enolase OS=Alkaliphilus metalliredigens (strain QYMF) GN=eno PE=3 SV=1 3 429 7.0E-139
sp|A7FQP0|ENO_CLOB1 Enolase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=eno PE=3 SV=1 3 429 9.0E-139
sp|B9KA91|ENO_THENN Enolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=eno PE=3 SV=1 3 429 1.0E-138
sp|Q6M075|ENO_METMP Enolase OS=Methanococcus maripaludis (strain S2 / LL) GN=eno PE=3 SV=2 3 433 1.0E-138
sp|C1F9E6|ENO_ACIC5 Enolase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=eno PE=3 SV=1 3 438 1.0E-138
sp|B1LCF4|ENO_THESQ Enolase OS=Thermotoga sp. (strain RQ2) GN=eno PE=3 SV=1 3 429 2.0E-138
sp|Q0B080|ENO_SYNWW Enolase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=eno PE=3 SV=1 3 429 2.0E-138
sp|Q8TUV6|ENO_METKA Enolase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=eno PE=3 SV=1 3 431 2.0E-138
sp|A7G9Y3|ENO_CLOBL Enolase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=eno PE=3 SV=1 3 429 2.0E-138
sp|B1IDB9|ENO_CLOBK Enolase OS=Clostridium botulinum (strain Okra / Type B1) GN=eno PE=3 SV=1 3 429 2.0E-138
sp|A4FZA6|ENO_METM5 Enolase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=eno PE=3 SV=2 3 433 2.0E-138
sp|Q042F4|ENO2_LACGA Enolase 2 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=eno2 PE=1 SV=1 3 431 3.0E-138
sp|A6L3M9|ENO_BACV8 Enolase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=eno PE=3 SV=1 1 427 3.0E-138
sp|A4XKV0|ENO_CALS8 Enolase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=eno PE=3 SV=1 1 431 3.0E-138
sp|Q15QR6|ENO_PSEA6 Enolase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=eno PE=3 SV=1 3 429 4.0E-138
sp|B0SRL5|ENO_LEPBP Enolase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=eno PE=3 SV=1 2 431 4.0E-138
sp|B0S8S8|ENO_LEPBA Enolase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=eno PE=3 SV=1 2 431 4.0E-138
sp|Q47SV1|ENO_THEFY Enolase OS=Thermobifida fusca (strain YX) GN=eno PE=3 SV=1 2 431 4.0E-138
sp|B3EEQ2|ENO_CHLL2 Enolase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=eno PE=3 SV=1 3 433 4.0E-138
sp|B1MKG1|ENO_MYCA9 Enolase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=eno PE=3 SV=1 3 429 5.0E-138
sp|Q8R967|ENO_CALS4 Enolase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=eno PE=3 SV=1 2 431 6.0E-138
sp|Q11QE1|ENO_CYTH3 Enolase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=eno PE=3 SV=1 3 434 6.0E-138
sp|B9J4M4|ENO_BACCQ Enolase OS=Bacillus cereus (strain Q1) GN=eno PE=3 SV=1 3 429 7.0E-138
sp|B7HW52|ENO_BACC7 Enolase OS=Bacillus cereus (strain AH187) GN=eno PE=3 SV=1 3 429 7.0E-138
sp|Q72XY5|ENO_BACC1 Enolase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=eno PE=3 SV=1 3 429 7.0E-138
sp|A0PYP4|ENO_CLONN Enolase OS=Clostridium novyi (strain NT) GN=eno PE=3 SV=1 3 434 7.0E-138
sp|O66778|ENO_AQUAE Enolase OS=Aquifex aeolicus (strain VF5) GN=eno PE=3 SV=1 3 429 1.0E-137
sp|A7HNS8|ENO_FERNB Enolase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=eno PE=3 SV=1 3 429 2.0E-137
sp|A6VJ31|ENO_METM7 Enolase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=eno PE=3 SV=2 3 433 2.0E-137
sp|B1KTJ8|ENO_CLOBM Enolase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=eno PE=3 SV=1 3 429 2.0E-137
sp|Q815K8|ENO_BACCR Enolase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=eno PE=3 SV=1 3 429 3.0E-137
sp|B7HED2|ENO_BACC4 Enolase OS=Bacillus cereus (strain B4264) GN=eno PE=3 SV=1 3 429 3.0E-137
sp|Q38Y18|ENO_LACSS Enolase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=eno PE=3 SV=1 3 431 3.0E-137
sp|B7IP20|ENO_BACC2 Enolase OS=Bacillus cereus (strain G9842) GN=eno PE=3 SV=1 3 429 4.0E-137
sp|C4K4K1|ENO_HAMD5 Enolase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=eno PE=3 SV=1 3 429 4.0E-137
sp|Q9F2Q3|ENO1_STRCO Enolase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=eno1 PE=3 SV=1 2 429 5.0E-137
sp|Q5R143|ENO_IDILO Enolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=eno PE=3 SV=1 3 437 5.0E-137
sp|P33675|ENO_ZYMMO Enolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=eno PE=1 SV=2 2 435 6.0E-137
sp|B8GAX5|ENO_CHLAD Enolase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=eno PE=3 SV=1 3 431 6.0E-137
sp|Q03AK4|ENO_LACC3 Enolase OS=Lactobacillus casei (strain ATCC 334) GN=eno PE=3 SV=1 3 429 6.0E-137
sp|Q89Z05|ENO_BACTN Enolase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=eno PE=3 SV=1 1 427 7.0E-137
sp|Q31CX3|ENO_PROM9 Enolase OS=Prochlorococcus marinus (strain MIT 9312) GN=eno PE=3 SV=1 3 429 8.0E-137
sp|Q03GW5|ENO_PEDPA Enolase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=eno PE=3 SV=1 3 431 1.0E-136
sp|Q8KNX9|ENO_BACFR Enolase OS=Bacteroides fragilis (strain YCH46) GN=eno PE=3 SV=1 1 427 1.0E-136
sp|Q5LG64|ENO_BACFN Enolase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=eno PE=3 SV=1 1 427 1.0E-136
sp|B9MS47|ENO_CALBD Enolase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=eno PE=3 SV=1 1 431 1.0E-136
sp|Q31G68|ENO_THICR Enolase OS=Thiomicrospira crunogena (strain XCL-2) GN=eno PE=3 SV=1 3 431 1.0E-136
sp|B1YLD8|ENO_EXIS2 Enolase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=eno PE=3 SV=1 3 429 1.0E-136
sp|Q898R0|ENO_CLOTE Enolase OS=Clostridium tetani (strain Massachusetts / E88) GN=eno PE=3 SV=1 3 429 1.0E-136
sp|Q2IID9|ENO_ANADE Enolase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=eno PE=3 SV=1 3 437 2.0E-136
sp|B3WCW7|ENO_LACCB Enolase OS=Lactobacillus casei (strain BL23) GN=eno PE=3 SV=1 3 429 3.0E-136
sp|B8JAC4|ENO_ANAD2 Enolase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=eno PE=3 SV=1 3 437 4.0E-136
sp|B4UDM8|ENO_ANASK Enolase OS=Anaeromyxobacter sp. (strain K) GN=eno PE=3 SV=1 3 437 4.0E-136
sp|A2CDE2|ENO_PROM3 Enolase OS=Prochlorococcus marinus (strain MIT 9303) GN=eno PE=3 SV=1 1 429 5.0E-136
sp|Q6AAB8|ENO_PROAC Enolase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=eno PE=3 SV=1 3 431 5.0E-136
sp|Q8FQS7|ENO_COREF Enolase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=eno PE=3 SV=1 3 429 6.0E-136
sp|A7HCC4|ENO_ANADF Enolase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=eno PE=3 SV=1 3 436 6.0E-136
sp|A0M568|ENO_GRAFK Enolase OS=Gramella forsetii (strain KT0803) GN=eno PE=3 SV=1 2 427 6.0E-136
sp|A6W6X2|ENO_KINRD Enolase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=eno PE=3 SV=1 3 429 6.0E-136
sp|B2GM13|ENO_KOCRD Enolase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=eno PE=3 SV=1 3 431 7.0E-136
sp|B9MEQ4|ENO_ACIET Enolase OS=Acidovorax ebreus (strain TPSY) GN=eno PE=3 SV=1 2 429 7.0E-136
sp|Q7V377|ENO_PROMP Enolase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=eno PE=3 SV=1 3 429 7.0E-136
sp|A1BD13|ENO_CHLPD Enolase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=eno PE=3 SV=1 3 433 9.0E-136
sp|A9WCM4|ENO_CHLAA Enolase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=eno PE=1 SV=1 3 429 9.0E-136
sp|Q74K78|ENO1_LACJO Enolase 1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=eno1 PE=3 SV=1 3 431 9.0E-136
sp|Q88YH3|ENO1_LACPL Enolase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=eno1 PE=3 SV=1 3 429 1.0E-135
sp|B0S1G7|ENO_FINM2 Enolase OS=Finegoldia magna (strain ATCC 29328) GN=eno PE=3 SV=1 2 429 1.0E-135
sp|A2BP03|ENO_PROMS Enolase OS=Prochlorococcus marinus (strain AS9601) GN=eno PE=3 SV=1 3 429 2.0E-135
sp|Q181T5|ENO_PEPD6 Enolase OS=Peptoclostridium difficile (strain 630) GN=eno PE=3 SV=1 3 429 2.0E-135
sp|Q7V483|ENO_PROMM Enolase OS=Prochlorococcus marinus (strain MIT 9313) GN=eno PE=3 SV=1 1 429 2.0E-135
sp|A0ALD9|ENO_LISW6 Enolase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=eno PE=3 SV=1 3 431 2.0E-135
sp|P64074|ENO_LISMO Enolase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=eno PE=1 SV=1 3 431 2.0E-135
sp|P64075|ENO_LISIN Enolase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=eno PE=3 SV=1 3 431 2.0E-135
sp|Q03SL5|ENO_LACBA Enolase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=eno PE=3 SV=1 3 431 2.0E-135
sp|B8DDA1|ENO_LISMH Enolase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=eno PE=3 SV=1 3 429 2.0E-135
sp|Q71WX1|ENO_LISMF Enolase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=eno PE=3 SV=1 3 429 2.0E-135
sp|C1KY94|ENO_LISMC Enolase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=eno PE=3 SV=1 3 429 2.0E-135
sp|Q73P50|ENO_TREDE Enolase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=eno PE=3 SV=1 3 429 2.0E-135
sp|A3PAS6|ENO_PROM0 Enolase OS=Prochlorococcus marinus (strain MIT 9301) GN=eno PE=3 SV=1 3 429 3.0E-135
sp|P37869|ENO_BACSU Enolase OS=Bacillus subtilis (strain 168) GN=eno PE=1 SV=4 3 431 3.0E-135
sp|Q5M561|ENO_STRT2 Enolase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=eno PE=3 SV=1 3 429 3.0E-135
sp|Q5M0M5|ENO_STRT1 Enolase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=eno PE=3 SV=1 3 429 3.0E-135
sp|Q2J619|ENO_FRASC Enolase OS=Frankia sp. (strain CcI3) GN=eno PE=3 SV=1 2 423 4.0E-135
sp|Q03LI0|ENO_STRTD Enolase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=eno PE=3 SV=1 3 429 5.0E-135
sp|B5RLS2|ENO_BORDL Enolase OS=Borrelia duttonii (strain Ly) GN=eno PE=3 SV=1 3 437 5.0E-135
sp|Q82HH5|ENO_STRAW Enolase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=eno PE=3 SV=1 2 435 5.0E-135
sp|A8G2L5|ENO_PROM2 Enolase OS=Prochlorococcus marinus (strain MIT 9215) GN=eno PE=3 SV=1 3 429 6.0E-135
sp|A7Z8Y1|ENO_BACMF Enolase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=eno PE=3 SV=1 3 431 6.0E-135
sp|P64081|ENO_STRA5 Enolase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|P64080|ENO_STRA3 Enolase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|Q3K2B2|ENO_STRA1 Enolase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|A3CMA7|ENO_STRSV Enolase OS=Streptococcus sanguinis (strain SK36) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|C1CRM6|ENO_STRZT Enolase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|C1CKJ0|ENO_STRZP Enolase OS=Streptococcus pneumoniae (strain P1031) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|C1CEB3|ENO_STRZJ Enolase OS=Streptococcus pneumoniae (strain JJA) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|Q97QS2|ENO_STRPN Enolase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=eno PE=1 SV=1 3 429 8.0E-135
sp|B8ZPW9|ENO_STRPJ Enolase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|B1IBR3|ENO_STRPI Enolase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|C1C7C0|ENO_STRP7 Enolase OS=Streptococcus pneumoniae (strain 70585) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|B5E4P1|ENO_STRP4 Enolase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=eno PE=3 SV=1 3 429 8.0E-135
sp|B1V8R6|ENO_PHYAS Enolase OS=Phytoplasma australiense GN=eno PE=3 SV=1 3 423 9.0E-135
sp|Q6MPQ2|ENO_BDEBA Enolase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=eno PE=3 SV=1 3 427 1.0E-134
sp|Q8RP81|ENO_STRAG Enolase OS=Streptococcus agalactiae GN=eno PE=1 SV=1 3 429 1.0E-134
sp|Q24MW5|ENO2_DESHY Enolase 2 OS=Desulfitobacterium hafniense (strain Y51) GN=eno2 PE=3 SV=1 3 429 1.0E-134
sp|C0Z6L3|ENO_BREBN Enolase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=eno PE=3 SV=1 3 429 2.0E-134
sp|A1SF66|ENO_NOCSJ Enolase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=eno PE=3 SV=1 2 431 2.0E-134
sp|Q8DPS0|ENO_STRR6 Enolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=eno PE=1 SV=1 3 429 2.0E-134
sp|B2IPX8|ENO_STRPS Enolase OS=Streptococcus pneumoniae (strain CGSP14) GN=eno PE=3 SV=1 3 429 2.0E-134
sp|Q04KG2|ENO_STRP2 Enolase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=eno PE=3 SV=1 3 429 2.0E-134
sp|A4W2T1|ENO_STRS2 Enolase OS=Streptococcus suis (strain 98HAH33) GN=eno PE=3 SV=1 3 431 2.0E-134
sp|B5RRF1|ENO_BORRA Enolase OS=Borrelia recurrentis (strain A1) GN=eno PE=3 SV=1 3 437 2.0E-134
sp|A1TEE4|ENO_MYCVP Enolase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=eno PE=3 SV=1 3 429 3.0E-134
sp|Q5FNN5|ENO_GLUOX Enolase OS=Gluconobacter oxydans (strain 621H) GN=eno PE=3 SV=1 2 434 3.0E-134
sp|A0B7E8|ENO_METTP Enolase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=eno PE=3 SV=1 1 429 3.0E-134
sp|B1VFL0|ENO_CORU7 Enolase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=eno PE=3 SV=1 3 429 3.0E-134
sp|C1A306|ENO_RHOE4 Enolase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=eno PE=3 SV=1 2 429 4.0E-134
sp|C1CXJ3|ENO_DEIDV Enolase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=eno PE=3 SV=1 1 436 4.0E-134
sp|Q0I6K2|ENO_SYNS3 Enolase OS=Synechococcus sp. (strain CC9311) GN=eno PE=3 SV=1 1 429 4.0E-134
sp|A6VUU9|ENO_MARMS Enolase OS=Marinomonas sp. (strain MWYL1) GN=eno PE=3 SV=1 3 429 5.0E-134
sp|Q7U3T1|ENO_SYNPX Enolase OS=Synechococcus sp. (strain WH8102) GN=eno PE=3 SV=1 1 429 6.0E-134
sp|A5FUW3|ENO_ACICJ Enolase OS=Acidiphilium cryptum (strain JF-5) GN=eno PE=3 SV=1 2 434 7.0E-134
sp|Q0C0R3|ENO_HYPNA Enolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=eno PE=3 SV=1 3 429 7.0E-134
sp|A5V3E8|ENO_SPHWW Enolase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=eno PE=3 SV=1 2 436 9.0E-134
sp|A8L149|ENO_FRASN Enolase OS=Frankia sp. (strain EAN1pec) GN=eno PE=3 SV=1 2 429 1.0E-133
sp|B1HVS4|ENO_LYSSC Enolase OS=Lysinibacillus sphaericus (strain C3-41) GN=eno PE=3 SV=1 3 429 1.0E-133
sp|A2C038|ENO_PROM1 Enolase OS=Prochlorococcus marinus (strain NATL1A) GN=eno PE=3 SV=1 1 429 1.0E-133
sp|Q65EN2|ENO_BACLD Enolase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=eno PE=3 SV=1 3 429 1.0E-133
sp|A8AY46|ENO_STRGC Enolase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=eno PE=3 SV=1 3 429 1.0E-133
sp|B3EUH8|ENO_AMOA5 Enolase OS=Amoebophilus asiaticus (strain 5a2) GN=eno PE=3 SV=1 1 434 2.0E-133
sp|Q2NAQ1|ENO_ERYLH Enolase OS=Erythrobacter litoralis (strain HTCC2594) GN=eno PE=3 SV=1 2 429 2.0E-133
sp|Q0STE0|ENO_CLOPS Enolase OS=Clostridium perfringens (strain SM101 / Type A) GN=eno PE=3 SV=1 1 431 2.0E-133
sp|Q0TQZ2|ENO_CLOP1 Enolase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=eno PE=3 SV=1 1 431 2.0E-133
sp|B2UY16|ENO_CLOBA Enolase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=eno PE=3 SV=1 1 429 2.0E-133
sp|Q8XKU4|ENO_CLOPE Enolase OS=Clostridium perfringens (strain 13 / Type A) GN=eno PE=3 SV=1 1 431 2.0E-133
sp|A9BDH2|ENO_PROM4 Enolase OS=Prochlorococcus marinus (strain MIT 9211) GN=eno PE=3 SV=1 1 431 3.0E-133
sp|Q5XD01|ENO_STRP6 Enolase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=eno PE=1 SV=3 3 429 3.0E-133
sp|Q1ISS7|ENO_KORVE Enolase OS=Koribacter versatilis (strain Ellin345) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|Q2G662|ENO_NOVAD Enolase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=eno PE=3 SV=1 2 429 3.0E-133
sp|Q9K717|ENO_BACHD Enolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|B5XKM7|ENO_STRPZ Enolase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|P0DA95|ENO_STRPQ Enolase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|Q48UF7|ENO_STRPM Enolase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|A2RFE3|ENO_STRPG Enolase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|Q1J7I5|ENO_STRPF Enolase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|Q1JHQ6|ENO_STRPD Enolase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|P69951|ENO_STRP8 Enolase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=eno PE=3 SV=2 3 429 3.0E-133
sp|P0DA94|ENO_STRP3 Enolase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|P69949|ENO_STRP1 Enolase OS=Streptococcus pyogenes serotype M1 GN=eno PE=3 SV=2 3 429 3.0E-133
sp|Q1JML5|ENO_STRPC Enolase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|Q1JCN8|ENO_STRPB Enolase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=eno PE=3 SV=1 3 429 3.0E-133
sp|Q0APT2|ENO_MARMM Enolase OS=Maricaulis maris (strain MCS10) GN=eno PE=3 SV=2 2 429 4.0E-133
sp|Q110V4|ENO_TRIEI Enolase OS=Trichodesmium erythraeum (strain IMS101) GN=eno PE=3 SV=1 2 429 4.0E-133
sp|C0QRV6|ENO_PERMH Enolase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=eno PE=3 SV=1 3 429 5.0E-133
sp|B2TPW4|ENO_CLOBB Enolase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=eno PE=3 SV=1 1 429 5.0E-133
sp|C0MH89|ENO_STRS7 Enolase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=eno PE=3 SV=1 3 429 5.0E-133
sp|B4U2B8|ENO_STREM Enolase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=eno PE=3 SV=1 3 429 5.0E-133
sp|C0M6K5|ENO_STRE4 Enolase OS=Streptococcus equi subsp. equi (strain 4047) GN=eno PE=3 SV=1 3 429 5.0E-133
sp|Q2RLT8|ENO_MOOTA Enolase OS=Moorella thermoacetica (strain ATCC 39073) GN=eno PE=3 SV=1 3 429 6.0E-133
sp|Q1D401|ENO_MYXXD Enolase OS=Myxococcus xanthus (strain DK 1622) GN=eno PE=3 SV=1 3 437 6.0E-133
sp|A8M2Y3|ENO_SALAI Enolase OS=Salinispora arenicola (strain CNS-205) GN=eno PE=3 SV=1 3 429 7.0E-133
sp|A8FHJ0|ENO_BACP2 Enolase OS=Bacillus pumilus (strain SAFR-032) GN=eno PE=3 SV=1 3 429 7.0E-133
sp|A0Q5J9|ENO_FRATN Enolase OS=Francisella tularensis subsp. novicida (strain U112) GN=eno PE=3 SV=1 3 429 8.0E-133
sp|Q5SME1|ENO_THET8 Enolase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=eno PE=3 SV=1 3 429 9.0E-133
sp|Q72H85|ENO_THET2 Enolase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=eno PE=3 SV=1 3 429 9.0E-133
sp|Q8YRB0|ENO_NOSS1 Enolase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=eno PE=3 SV=1 2 429 9.0E-133
sp|A5FN12|ENO_FLAJ1 Enolase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=eno PE=3 SV=1 3 434 9.0E-133
sp|Q2NJ39|ENO_AYWBP Enolase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=eno PE=3 SV=1 3 421 9.0E-133
sp|Q2FQL9|ENO1_METHJ Enolase 1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=eno1 PE=3 SV=1 3 429 1.0E-132
sp|B3EL51|ENO_CHLPB Enolase OS=Chlorobium phaeobacteroides (strain BS1) GN=eno PE=3 SV=1 3 433 1.0E-132
sp|B0SYX8|ENO_CAUSK Enolase OS=Caulobacter sp. (strain K31) GN=eno PE=3 SV=1 3 429 1.0E-132
sp|Q3AVW5|ENO_SYNS9 Enolase OS=Synechococcus sp. (strain CC9902) GN=eno PE=3 SV=1 1 429 2.0E-132
sp|A6GZ69|ENO_FLAPJ Enolase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=eno PE=3 SV=1 3 434 2.0E-132
sp|Q8DTS9|ENO_STRMU Enolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=eno PE=1 SV=1 3 429 2.0E-132
sp|B9DRR9|ENO_STRU0 Enolase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=eno PE=3 SV=1 3 429 2.0E-132
sp|Q9XDS7|ENO_STRIT Enolase OS=Streptococcus intermedius GN=eno PE=3 SV=1 3 429 2.0E-132
sp|A9BIS7|ENO_PETMO Enolase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=eno PE=3 SV=1 3 431 2.0E-132
sp|C3KZ49|ENO_CLOB6 Enolase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=eno PE=3 SV=1 3 429 2.0E-132
sp|Q2A278|ENO_FRATH Enolase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=eno PE=3 SV=1 3 429 2.0E-132
sp|Q0BKV1|ENO_FRATO Enolase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=eno PE=3 SV=1 3 429 2.0E-132
sp|Q050L5|ENO_LEPBL Enolase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=eno PE=3 SV=1 3 429 2.0E-132
sp|Q04SI9|ENO_LEPBJ Enolase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=eno PE=3 SV=1 3 429 2.0E-132
sp|A8MFY2|ENO_ALKOO Enolase OS=Alkaliphilus oremlandii (strain OhILAs) GN=eno PE=3 SV=1 3 429 2.0E-132
sp|A4X3B7|ENO_SALTO Enolase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=eno PE=3 SV=1 3 430 2.0E-132
sp|B8HQY9|ENO_CYAP4 Enolase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=eno PE=3 SV=1 2 430 3.0E-132
sp|A5FRM5|ENO_DEHMB Enolase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=eno PE=3 SV=1 3 429 3.0E-132
sp|C6BSL8|ENO_DESAD Enolase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=eno PE=3 SV=1 3 435 3.0E-132
sp|A4T6L5|ENO_MYCGI Enolase OS=Mycobacterium gilvum (strain PYR-GCK) GN=eno PE=3 SV=1 3 429 3.0E-132
sp|A2BUI5|ENO_PROM5 Enolase OS=Prochlorococcus marinus (strain MIT 9515) GN=eno PE=3 SV=1 3 429 3.0E-132
sp|B2S044|ENO_BORHD Enolase OS=Borrelia hermsii (strain HS1 / DAH) GN=eno PE=3 SV=1 3 429 3.0E-132
sp|Q1WSY0|ENO_LACS1 Enolase OS=Lactobacillus salivarius (strain UCC118) GN=eno PE=3 SV=1 2 431 4.0E-132
sp|A9HJ75|ENO_GLUDA Enolase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=eno PE=3 SV=1 2 434 4.0E-132
sp|Q46HG5|ENO_PROMT Enolase OS=Prochlorococcus marinus (strain NATL2A) GN=eno PE=3 SV=1 1 429 4.0E-132
sp|C5C987|ENO_MICLC Enolase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=eno PE=3 SV=1 3 429 5.0E-132
sp|A0PW55|ENO_MYCUA Enolase OS=Mycobacterium ulcerans (strain Agy99) GN=eno PE=3 SV=1 3 429 5.0E-132
sp|Q0S4I1|ENO_RHOJR Enolase OS=Rhodococcus jostii (strain RHA1) GN=eno PE=3 SV=1 3 429 6.0E-132
sp|A1W4R1|ENO_ACISJ Enolase OS=Acidovorax sp. (strain JS42) GN=eno PE=3 SV=1 2 429 6.0E-132
sp|B2HDI5|ENO_MYCMM Enolase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=eno PE=3 SV=1 3 429 7.0E-132
sp|A4YVC0|ENO_BRASO Enolase OS=Bradyrhizobium sp. (strain ORS278) GN=eno PE=3 SV=1 2 436 7.0E-132
sp|B1GYL7|ENO_UNCTG Enolase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=eno PE=3 SV=1 3 429 8.0E-132
sp|Q8EW32|ENO_MYCPE Enolase OS=Mycoplasma penetrans (strain HF-2) GN=eno PE=3 SV=1 3 436 8.0E-132
sp|B7JW48|ENO_CYAP8 Enolase OS=Cyanothece sp. (strain PCC 8801) GN=eno PE=3 SV=1 3 428 9.0E-132
sp|A3DBQ5|ENO_CLOTH Enolase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=eno PE=3 SV=1 1 429 1.0E-131
sp|A1TLS5|ENO_ACIAC Enolase OS=Acidovorax citrulli (strain AAC00-1) GN=eno PE=3 SV=1 2 429 1.0E-131
sp|C1AY93|ENO_RHOOB Enolase OS=Rhodococcus opacus (strain B4) GN=eno PE=3 SV=1 3 429 1.0E-131
sp|A9NF93|ENO_ACHLI Enolase OS=Acholeplasma laidlawii (strain PG-8A) GN=eno PE=3 SV=1 3 429 1.0E-131
sp|B0C9F0|ENO_ACAM1 Enolase OS=Acaryochloris marina (strain MBIC 11017) GN=eno PE=3 SV=1 3 429 1.0E-131
sp|Q21V37|ENO_RHOFT Enolase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=eno PE=3 SV=1 2 429 2.0E-131
sp|Q3SL43|ENO_THIDA Enolase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=eno PE=3 SV=1 2 434 2.0E-131
sp|Q5NGW8|ENO_FRATT Enolase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=eno PE=3 SV=1 3 429 2.0E-131
sp|Q14IC0|ENO_FRAT1 Enolase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=eno PE=3 SV=1 3 429 2.0E-131
sp|B2GAM0|ENO_LACF3 Enolase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=eno PE=3 SV=1 3 438 2.0E-131
sp|Q6YQT9|ENO_ONYPE Enolase OS=Onion yellows phytoplasma (strain OY-M) GN=eno PE=3 SV=1 3 421 2.0E-131
sp|Q0BSX3|ENO_GRABC Enolase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=eno PE=3 SV=1 2 429 2.0E-131
sp|Q2W698|ENO_MAGSA Enolase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=eno PE=3 SV=1 2 434 2.0E-131
sp|Q215A2|ENO_RHOPB Enolase OS=Rhodopseudomonas palustris (strain BisB18) GN=eno PE=3 SV=1 2 435 2.0E-131
sp|B4RMD8|ENO_NEIG2 Enolase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=eno PE=3 SV=1 2 429 2.0E-131
sp|Q5F8Z2|ENO_NEIG1 Enolase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=eno PE=3 SV=1 2 429 2.0E-131
sp|Q0RCG8|ENO_FRAAA Enolase OS=Frankia alni (strain ACN14a) GN=eno PE=3 SV=2 2 423 2.0E-131
sp|C4LHL7|ENO_CORK4 Enolase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=eno PE=3 SV=1 3 429 3.0E-131
sp|B2V9N8|ENO_SULSY Enolase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=eno PE=3 SV=1 3 434 3.0E-131
sp|A5GPE0|ENO_SYNPW Enolase OS=Synechococcus sp. (strain WH7803) GN=eno PE=3 SV=1 1 429 3.0E-131
sp|C0R5N4|ENO_WOLWR Enolase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=eno PE=3 SV=1 3 427 3.0E-131
sp|A7INB6|ENO_XANP2 Enolase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=eno PE=3 SV=1 2 427 3.0E-131
sp|B7KL24|ENO_CYAP7 Enolase OS=Cyanothece sp. (strain PCC 7424) GN=eno PE=3 SV=1 3 428 4.0E-131
sp|B2J1R2|ENO_NOSP7 Enolase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=eno PE=3 SV=1 2 429 4.0E-131
sp|Q4L4K7|ENO_STAHJ Enolase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=eno PE=3 SV=1 3 429 4.0E-131
sp|P77972|ENO_SYNY3 Enolase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=eno PE=3 SV=1 3 428 5.0E-131
sp|C1A7Y3|ENO_GEMAT Enolase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=eno PE=3 SV=1 2 429 5.0E-131
sp|Q39T27|ENO_GEOMG Enolase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=eno PE=3 SV=1 3 434 5.0E-131
sp|A6TD53|ENO_KLEP7 Enolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=eno PE=3 SV=1 3 429 5.0E-131
sp|B9EAH1|ENO_MACCJ Enolase OS=Macrococcus caseolyticus (strain JCSC5402) GN=eno PE=3 SV=1 3 431 5.0E-131
sp|B9M3M1|ENO_GEODF Enolase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=eno PE=3 SV=1 3 429 5.0E-131
sp|B1Y4K4|ENO_LEPCP Enolase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=eno PE=3 SV=1 2 429 6.0E-131
sp|Q3AGS4|ENO_SYNSC Enolase OS=Synechococcus sp. (strain CC9605) GN=eno PE=3 SV=1 1 429 6.0E-131
sp|Q7VDY0|ENO_PROMA Enolase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=eno PE=3 SV=1 1 430 6.0E-131
sp|A9LZL4|ENO_NEIM0 Enolase OS=Neisseria meningitidis serogroup C (strain 053442) GN=eno PE=3 SV=1 2 429 7.0E-131
sp|Q8DL40|ENO_THEEB Enolase OS=Thermosynechococcus elongatus (strain BP-1) GN=eno PE=3 SV=1 2 428 7.0E-131
sp|A1S4D7|ENO_SHEAM Enolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=eno PE=3 SV=1 3 429 7.0E-131
sp|Q3ZX11|ENO_DEHMC Enolase OS=Dehalococcoides mccartyi (strain CBDB1) GN=eno PE=3 SV=1 3 429 7.0E-131
sp|Q136E5|ENO_RHOPS Enolase OS=Rhodopseudomonas palustris (strain BisB5) GN=eno PE=3 SV=1 2 435 7.0E-131
sp|B8EJT3|ENO_METSB Enolase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=eno PE=3 SV=1 2 436 7.0E-131
sp|Q741U7|ENO_MYCPA Enolase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=eno PE=3 SV=1 3 429 8.0E-131
sp|A0QBX4|ENO_MYCA1 Enolase OS=Mycobacterium avium (strain 104) GN=eno PE=3 SV=1 3 429 8.0E-131
sp|A5GEW5|ENO_GEOUR Enolase OS=Geobacter uraniireducens (strain Rf4) GN=eno PE=3 SV=1 3 429 8.0E-131
sp|B6YQN5|ENO_AZOPC Enolase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=eno PE=3 SV=1 1 427 9.0E-131
sp|Q9A7J9|ENO_CAUCR Enolase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=eno PE=3 SV=1 3 429 1.0E-130
sp|B8GW68|ENO_CAUCN Enolase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=eno PE=3 SV=1 3 429 1.0E-130
sp|Q9HXZ5|ENO_PSEAE Enolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=eno PE=3 SV=1 3 433 1.0E-130
sp|Q02RA7|ENO_PSEAB Enolase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=eno PE=1 SV=1 3 433 1.0E-130
sp|B7V7V4|ENO_PSEA8 Enolase OS=Pseudomonas aeruginosa (strain LESB58) GN=eno PE=3 SV=1 3 433 1.0E-130
sp|A6V1F3|ENO_PSEA7 Enolase OS=Pseudomonas aeruginosa (strain PA7) GN=eno PE=3 SV=1 3 433 1.0E-130
sp|B6JFY2|ENO_OLICO Enolase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=eno PE=3 SV=1 2 436 1.0E-130
sp|Q8CPY3|ENO_STAES Enolase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=eno PE=3 SV=1 3 429 1.0E-130
sp|Q5HQV0|ENO_STAEQ Enolase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=eno PE=3 SV=1 3 429 1.0E-130
sp|B2KBA5|ENO_ELUMP Enolase OS=Elusimicrobium minutum (strain Pei191) GN=eno PE=3 SV=1 3 434 1.0E-130
sp|B2IKR4|ENO_BEII9 Enolase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=eno PE=3 SV=1 2 436 1.0E-130
sp|Q5WDK9|ENO_BACSK Enolase OS=Bacillus clausii (strain KSM-K16) GN=eno PE=3 SV=1 3 429 1.0E-130
sp|Q48F79|ENO_PSE14 Enolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=eno PE=3 SV=1 3 433 2.0E-130
sp|Q2IWD0|ENO_RHOP2 Enolase OS=Rhodopseudomonas palustris (strain HaA2) GN=eno PE=3 SV=1 2 435 2.0E-130
sp|Q6KIB0|ENO_MYCMO Enolase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=eno PE=3 SV=1 2 429 2.0E-130
sp|Q1QZX7|ENO_CHRSD Enolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=eno PE=3 SV=1 3 429 2.0E-130
sp|Q2SSR3|ENO_MYCCT Enolase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|P64079|ENO_STAAW Enolase OS=Staphylococcus aureus (strain MW2) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|A8Z1A4|ENO_STAAT Enolase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|Q6GB54|ENO_STAAS Enolase OS=Staphylococcus aureus (strain MSSA476) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|Q6GIL4|ENO_STAAR Enolase OS=Staphylococcus aureus (strain MRSA252) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|P99088|ENO_STAAN Enolase OS=Staphylococcus aureus (strain N315) GN=eno PE=1 SV=1 3 429 3.0E-130
sp|P64078|ENO_STAAM Enolase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|A6QF85|ENO_STAAE Enolase OS=Staphylococcus aureus (strain Newman) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|Q5HHP1|ENO_STAAC Enolase OS=Staphylococcus aureus (strain COL) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|Q2YSE8|ENO_STAAB Enolase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|A5IQY0|ENO_STAA9 Enolase OS=Staphylococcus aureus (strain JH9) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|Q2G028|ENO_STAA8 Enolase OS=Staphylococcus aureus (strain NCTC 8325) GN=eno PE=1 SV=1 3 429 3.0E-130
sp|Q2FIL7|ENO_STAA3 Enolase OS=Staphylococcus aureus (strain USA300) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|A6TZQ5|ENO_STAA2 Enolase OS=Staphylococcus aureus (strain JH1) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|A7WZT2|ENO_STAA1 Enolase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=eno PE=3 SV=1 3 429 3.0E-130
sp|Q3Z8W4|ENO_DEHM1 Enolase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=eno PE=3 SV=1 3 429 4.0E-130
sp|Q6MTZ2|ENO_MYCMS Enolase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=eno PE=3 SV=1 3 429 4.0E-130
sp|Q74AR6|ENO_GEOSL Enolase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=eno PE=3 SV=1 3 429 4.0E-130
sp|B0TK04|ENO_SHEHH Enolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=eno PE=3 SV=1 3 429 4.0E-130
sp|Q07ND9|ENO_RHOP5 Enolase OS=Rhodopseudomonas palustris (strain BisA53) GN=eno PE=3 SV=1 2 436 5.0E-130
sp|Q3A578|ENO_PELCD Enolase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=eno PE=3 SV=1 3 429 5.0E-130
sp|B6IQ30|ENO_RHOCS Enolase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=eno PE=3 SV=1 2 429 5.0E-130
sp|Q89KV6|ENO_BRADU Enolase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=eno PE=3 SV=1 2 436 6.0E-130
sp|Q1MS78|ENO_LAWIP Enolase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=eno PE=3 SV=1 2 435 6.0E-130
sp|A8H1S5|ENO_SHEPA Enolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=eno PE=3 SV=1 3 429 6.0E-130
sp|Q9JU46|ENO_NEIMA Enolase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=eno PE=3 SV=1 2 427 6.0E-130
sp|Q9JZ53|ENO_NEIMB Enolase OS=Neisseria meningitidis serogroup B (strain MC58) GN=eno PE=3 SV=1 2 427 6.0E-130
sp|Q8ENP5|ENO_OCEIH Enolase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=eno PE=3 SV=1 3 429 7.0E-130
sp|A6VR00|ENO_ACTSZ Enolase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=eno PE=3 SV=1 3 429 7.0E-130
sp|Q8RI55|ENO_FUSNN Enolase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=eno PE=3 SV=1 2 429 7.0E-130
sp|Q8PLS0|ENO_XANAC Enolase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=eno PE=3 SV=1 3 429 7.0E-130
sp|B5XV19|ENO_KLEP3 Enolase OS=Klebsiella pneumoniae (strain 342) GN=eno PE=3 SV=1 3 429 7.0E-130
sp|Q9CD42|ENO_MYCLE Enolase OS=Mycobacterium leprae (strain TN) GN=eno PE=3 SV=2 3 429 7.0E-130
sp|Q3BUT0|ENO_XANC5 Enolase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=eno PE=3 SV=1 3 429 8.0E-130
sp|Q5GYK4|ENO_XANOR Enolase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=eno PE=3 SV=2 3 429 8.0E-130
sp|B2SUA6|ENO_XANOP Enolase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=eno PE=3 SV=1 3 429 8.0E-130
sp|Q2P1K8|ENO_XANOM Enolase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=eno PE=3 SV=1 3 429 8.0E-130
sp|B7GTK2|ENO_BIFLS Enolase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=eno PE=3 SV=1 3 435 8.0E-130
sp|Q6MEY2|ENO_PARUW Enolase OS=Protochlamydia amoebophila (strain UWE25) GN=eno PE=3 SV=1 3 431 8.0E-130
sp|Q47DI1|ENO_DECAR Enolase OS=Dechloromonas aromatica (strain RCB) GN=eno PE=3 SV=1 2 429 9.0E-130
sp|A0LEC9|ENO_SYNFM Enolase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=eno PE=3 SV=1 3 433 9.0E-130
sp|O69174|ENO_STAAU Enolase OS=Staphylococcus aureus GN=eno PE=1 SV=1 3 429 9.0E-130
sp|A4G737|ENO_HERAR Enolase OS=Herminiimonas arsenicoxydans GN=eno PE=3 SV=1 2 431 1.0E-129
sp|A5WG13|ENO_PSYWF Enolase OS=Psychrobacter sp. (strain PRwf-1) GN=eno PE=3 SV=1 3 429 1.0E-129
sp|Q47WR1|ENO_COLP3 Enolase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=eno PE=3 SV=1 3 429 1.0E-129
sp|Q4ZWQ8|ENO1_PSEU2 Enolase 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=eno1 PE=3 SV=1 3 433 1.0E-129
sp|C5CSV6|ENO_VARPS Enolase OS=Variovorax paradoxus (strain S110) GN=eno PE=3 SV=1 2 429 1.0E-129
sp|B8J467|ENO_DESDA Enolase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=eno PE=3 SV=1 2 429 1.0E-129
sp|A5EK13|ENO_BRASB Enolase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=eno PE=3 SV=1 2 436 2.0E-129
sp|Q661T0|ENO_BORBP Enolase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=eno PE=3 SV=1 3 431 2.0E-129
sp|Q9RR60|ENO_DEIRA Enolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=eno PE=3 SV=1 1 436 2.0E-129
sp|B4RBW1|ENO_PHEZH Enolase OS=Phenylobacterium zucineum (strain HLK1) GN=eno PE=3 SV=1 3 436 2.0E-129
sp|A8IBF3|ENO_AZOC5 Enolase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=eno PE=3 SV=1 2 435 2.0E-129
sp|B2S455|ENO_TREPS Enolase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=eno PE=3 SV=1 3 429 2.0E-129
sp|P74934|ENO_TREPA Enolase OS=Treponema pallidum (strain Nichols) GN=eno PE=3 SV=1 3 429 2.0E-129
sp|Q3YY77|ENO_SHISS Enolase OS=Shigella sonnei (strain Ss046) GN=eno PE=3 SV=1 3 429 3.0E-129
sp|Q0SNH5|ENO_BORAP Enolase OS=Borrelia afzelii (strain PKo) GN=eno PE=3 SV=1 3 431 3.0E-129
sp|B9DJJ9|ENO_STACT Enolase OS=Staphylococcus carnosus (strain TM300) GN=eno PE=3 SV=1 3 431 3.0E-129
sp|B1MVW3|ENO_LEUCK Enolase OS=Leuconostoc citreum (strain KM20) GN=eno PE=3 SV=1 3 431 3.0E-129
sp|Q3SRK4|ENO_NITWN Enolase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=eno PE=3 SV=1 2 436 3.0E-129
sp|A2SJR2|ENO_METPP Enolase OS=Methylibium petroleiphilum (strain PM1) GN=eno PE=3 SV=1 2 429 4.0E-129
sp|O51312|ENO_BORBU Enolase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=eno PE=3 SV=1 3 429 5.0E-129
sp|Q7UIR2|ENO_RHOBA Enolase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=eno PE=3 SV=1 3 436 5.0E-129
sp|A6SXG3|ENO_JANMA Enolase OS=Janthinobacterium sp. (strain Marseille) GN=eno PE=3 SV=1 2 429 5.0E-129
sp|B7J1R2|ENO_BORBZ Enolase OS=Borrelia burgdorferi (strain ZS7) GN=eno PE=3 SV=1 3 429 5.0E-129
sp|A1APJ8|ENO_PELPD Enolase OS=Pelobacter propionicus (strain DSM 2379) GN=eno PE=3 SV=1 3 429 5.0E-129
sp|Q73HQ2|ENO_WOLPM Enolase OS=Wolbachia pipientis wMel GN=eno PE=3 SV=1 3 427 5.0E-129
sp|Q8P9Z3|ENO_XANCP Enolase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=eno PE=3 SV=1 3 429 6.0E-129
sp|B0RU05|ENO_XANCB Enolase OS=Xanthomonas campestris pv. campestris (strain B100) GN=eno PE=3 SV=1 3 429 6.0E-129
sp|Q4UTP2|ENO_XANC8 Enolase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=eno PE=3 SV=1 3 429 6.0E-129
sp|B3E2S8|ENO_GEOLS Enolase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=eno PE=3 SV=1 3 431 7.0E-129
sp|A9W6G9|ENO_METEP Enolase OS=Methylobacterium extorquens (strain PA1) GN=eno PE=3 SV=1 2 429 7.0E-129
sp|Q49W03|ENO_STAS1 Enolase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=eno PE=3 SV=1 3 429 8.0E-129
sp|Q2Y9P0|ENO_NITMU Enolase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=eno PE=3 SV=1 2 429 8.0E-129
sp|Q28RE8|ENO_JANSC Enolase OS=Jannaschia sp. (strain CCS1) GN=eno PE=3 SV=1 3 434 9.0E-129
sp|Q8G5I9|ENO_BIFLO Enolase OS=Bifidobacterium longum (strain NCC 2705) GN=eno PE=3 SV=1 3 435 9.0E-129
sp|B3DSV2|ENO_BIFLD Enolase OS=Bifidobacterium longum (strain DJO10A) GN=eno PE=3 SV=1 3 435 9.0E-129
sp|Q886M3|ENO1_PSESM Enolase 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=eno1 PE=3 SV=1 3 433 1.0E-128
sp|B9JW75|ENO_AGRVS Enolase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=eno PE=3 SV=1 2 435 1.0E-128
sp|B1ZEJ8|ENO_METPB Enolase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=eno PE=3 SV=1 2 429 2.0E-128
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8359
MAITKVHARSVYDSRGNPTVEVDVVTDTGLHRAIVPSGASTGQHEACELRDGDKAKWGGKGVSKAVDNVNTTIGP
ALIKEGVDVKDQSKVDAFLNKLDGTANKTKLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
MNVLNGGSHAGGRLAFQEFMIVPSDAPTFSEAMRQGAEVYQQLKGLAKKKYGQSAGNVGDEGGVAPDIQTADEAL
DLITEAIEKAGYTGKMNIAMDVASSEFYKEKEKKYDLDFKNPKSDPSKWITYEELAAMYSELCKKYPIVSIEDPF
AEDDWEAWSYFYKTQDIQIVGDDLTVTNPLRIKKAIELKACNALLLKVNQIGTLTESIQAAKDSYADGWGVMVSH
RSGETEDVTIADIVVGIRSGEIKTGAPCRSERLAKLNQILRIEEELGDQAVYAGTNFRKAVNL*
Coding >Hirsu2|8359
ATGGCCATCACCAAGGTTCACGCGCGCTCCGTTTACGACTCCCGCGGCAACCCGACCGTCGAGGTCGACGTCGTC
ACTGACACTGGCCTCCACCGTGCCATTGTCCCGTCTGGAGCCTCTACCGGTCAGCACGAGGCTTGCGAGCTTCGT
GATGGCGACAAGGCTAAATGGGGCGGCAAGGGTGTCAGCAAGGCCGTCGACAACGTCAACACCACTATTGGCCCC
GCCCTGATCAAAGAGGGTGTCGATGTCAAGGACCAGTCCAAGGTCGATGCTTTCCTCAACAAGCTCGACGGCACC
GCCAACAAAACCAAGCTCGGAGCCAATGCCATCCTCGGCGTCAGTCTGGCTGTTGCCAAAGCTGGCGCTGCTGAA
AAGGGTGTGCCCCTGTACGCCCACATCTCCGATCTCGCCGGAACCAAGAAGCCATATGTTCTGCCCGTGCCTTTC
ATGAACGTTTTGAACGGGGGGTCTCACGCCGGCGGCCGTCTCGCCTTCCAGGAGTTTATGATTGTCCCCAGTGAT
GCGCCCACTTTCTCCGAGGCCATGCGCCAGGGCGCCGAGGTGTACCAGCAGCTGAAGGGTCTTGCCAAGAAGAAG
TATGGCCAGTCCGCAGGCAACGTCGGCGACGAAGGCGGTGTTGCTCCCGATATCCAGACAGCCGACGAGGCTCTG
GACCTCATCACTGAGGCCATCGAGAAGGCTGGCTACACTGGCAAGATGAACATCGCCATGGACGTTGCCTCCAGT
GAGTTCTACAAGGAGAAAGAGAAGAAGTACGACCTCGACTTCAAGAACCCGAAGAGCGACCCGTCCAAGTGGATC
ACGTACGAAGAACTTGCCGCCATGTACTCCGAGCTCTGCAAGAAGTATCCCATCGTATCCATCGAAGACCCCTTC
GCCGAAGACGACTGGGAGGCCTGGAGCTACTTCTACAAGACTCAGGACATCCAGATTGTCGGCGACGACCTGACT
GTCACCAACCCGCTGCGCATCAAGAAGGCCATTGAGCTCAAGGCCTGCAACGCCCTCCTCCTCAAGGTCAATCAG
ATCGGCACCCTGACGGAGTCGATCCAGGCCGCCAAGGACTCTTACGCCGACGGCTGGGGTGTCATGGTGTCTCAC
CGATCTGGCGAGACGGAGGACGTCACCATTGCTGACATCGTCGTTGGCATCCGGTCTGGTGAGATCAAGACTGGC
GCGCCCTGCCGGTCTGAGCGACTTGCCAAGCTCAACCAGATCCTTCGCATCGAGGAGGAGCTTGGCGATCAGGCT
GTCTACGCCGGTACCAACTTCCGCAAGGCTGTTAATCTGTAA
Transcript >Hirsu2|8359
ATGGCCATCACCAAGGTTCACGCGCGCTCCGTTTACGACTCCCGCGGCAACCCGACCGTCGAGGTCGACGTCGTC
ACTGACACTGGCCTCCACCGTGCCATTGTCCCGTCTGGAGCCTCTACCGGTCAGCACGAGGCTTGCGAGCTTCGT
GATGGCGACAAGGCTAAATGGGGCGGCAAGGGTGTCAGCAAGGCCGTCGACAACGTCAACACCACTATTGGCCCC
GCCCTGATCAAAGAGGGTGTCGATGTCAAGGACCAGTCCAAGGTCGATGCTTTCCTCAACAAGCTCGACGGCACC
GCCAACAAAACCAAGCTCGGAGCCAATGCCATCCTCGGCGTCAGTCTGGCTGTTGCCAAAGCTGGCGCTGCTGAA
AAGGGTGTGCCCCTGTACGCCCACATCTCCGATCTCGCCGGAACCAAGAAGCCATATGTTCTGCCCGTGCCTTTC
ATGAACGTTTTGAACGGGGGGTCTCACGCCGGCGGCCGTCTCGCCTTCCAGGAGTTTATGATTGTCCCCAGTGAT
GCGCCCACTTTCTCCGAGGCCATGCGCCAGGGCGCCGAGGTGTACCAGCAGCTGAAGGGTCTTGCCAAGAAGAAG
TATGGCCAGTCCGCAGGCAACGTCGGCGACGAAGGCGGTGTTGCTCCCGATATCCAGACAGCCGACGAGGCTCTG
GACCTCATCACTGAGGCCATCGAGAAGGCTGGCTACACTGGCAAGATGAACATCGCCATGGACGTTGCCTCCAGT
GAGTTCTACAAGGAGAAAGAGAAGAAGTACGACCTCGACTTCAAGAACCCGAAGAGCGACCCGTCCAAGTGGATC
ACGTACGAAGAACTTGCCGCCATGTACTCCGAGCTCTGCAAGAAGTATCCCATCGTATCCATCGAAGACCCCTTC
GCCGAAGACGACTGGGAGGCCTGGAGCTACTTCTACAAGACTCAGGACATCCAGATTGTCGGCGACGACCTGACT
GTCACCAACCCGCTGCGCATCAAGAAGGCCATTGAGCTCAAGGCCTGCAACGCCCTCCTCCTCAAGGTCAATCAG
ATCGGCACCCTGACGGAGTCGATCCAGGCCGCCAAGGACTCTTACGCCGACGGCTGGGGTGTCATGGTGTCTCAC
CGATCTGGCGAGACGGAGGACGTCACCATTGCTGACATCGTCGTTGGCATCCGGTCTGGTGAGATCAAGACTGGC
GCGCCCTGCCGGTCTGAGCGACTTGCCAAGCTCAACCAGATCCTTCGCATCGAGGAGGAGCTTGGCGATCAGGCT
GTCTACGCCGGTACCAACTTCCGCAAGGCTGTTAATCTGTAA
Gene >Hirsu2|8359
ATGGCCATCACCAAGGTTCACGCGCGCTCCGTTTACGACTCCCGCGGCAACCCGACCGTCGAGGTCGACGTCGTC
ACTGACACTGGCCTCCACCGTGCCATTGTCCCGTCTGGAGCCTCTACCGGTTCGTTCCGATACTCCCCGCTCCGA
CAAATTGACGTTGCAGACGGGTAACCGGATGCTGGTACAGGTCAGCACGAGGCTTGCGAGCTTCGTGATGGCGAC
AAGGCTAAATGGGGCGGCAAGGGTGTCAGCAAGGCCGTCGACAACGTCAACACCACTATTGGCCCCGCCCTGATC
AAAGAGGGTGTCGATGTCAAGGACCAGTCCAAGGTCGATGCTTTCCTCAACAAGCTCGACGGCACCGCCAACAAA
ACCAAGCTCGGAGCCAATGCCATCCTCGGCGTCAGTCTGGCTGTTGCCAAAGCTGGCGCTGCTGAAAAGGTTACC
ACCCCGGACCGAATCTGCGTCTTGCTGGCTTGTGTGCTAACTGGGCCCAGGGTGTGCCCCTGTACGCCCACATCT
CCGATCTCGCCGGAACCAAGAAGCCATATGTTCTGCCCGTGCCTTTCATGAACGTTTTGAACGGGGGGTAAGCGC
CAGGTTGGATGCACAACCCGGACGGAATAGAGCTGACTGTCCAAGGTCTCACGCCGGCGGCCGTCTCGCCTTCCA
GGAGTTTATGATTGTCCCCAGGTGAGCACTGGACTCGGGCCCTCGATTGGCTCGCGTTCCCCAGCCTGACACCGA
AAACAGTGATGCGCCCACTTTCTCCGAGGCCATGCGCCAGGGCGCCGAGGTGTACCAGCAGCTGAAGGGTCTTGC
CAAGAAGAAGTATGGCCAGTCCGCAGGCAACGTCGGCGACGAAGGCGGTGTTGCTCCCGATATCCAGACAGCCGA
CGAGGCTCTGGACCTCATCACTGAGGCCATCGAGAAGGCTGGCTACACTGGCAAGATGAACATCGCCATGGACGT
TGCCTCCAGTGAGTTCTACAAGGAGAAAGAGAAGAAGTACGACCTCGACTTCAAGAACCCGAAGAGCGACCCGTC
CAAGTGGATCACGTACGAAGAACTTGCCGCCATGTACTCCGAGCTCTGCAAGAAGTATCCCATCGTATCCATCGA
AGACCCCTTCGCCGAAGACGACTGGGAGGCCTGGAGCTACTTCTACAAGACTCAGGACATCCAGATTGTCGGCGA
CGACCTGACTGTCACCAACCCGCTGCGCATCAAGAAGGCCATTGAGCTCAAGGCCTGCAACGCCCTCCTCCTCAA
GGTCAATCAGATCGGCACCCTGACGGAGTCGATCCAGGCCGCCAAGGACTCTTACGCCGACGGCTGGGGTGTCAT
GGTGTCTCACCGATCTGGCGAGACGGAGGACGTCACCATTGCTGACATCGTCGTTGGCATCCGGTCTGGTGAGAT
CAAGACTGGCGCGCCCTGCCGGTCTGAGCGACTTGCCAAGCTCAACCAGATCCTTCGCATCGAGGAGGAGCTTGG
CGATCAGGCTGTCTACGCCGGTACCAACTTCCGCAAGGCTGTTAATCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail