Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8354
Gene name
LocationContig_54:15632..17474
Strand+
Gene length (bp)1842
Transcript length (bp)1842
Coding sequence length (bp)1842
Protein length (aa) 614

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 5.9E-03 257 279
PF00096 zf-C2H2 Zinc finger, C2H2 type 2.9E-03 285 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 259 337 7.0E-19
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 256 337 1.0E-18
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 250 340 1.0E-17
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 250 340 1.0E-17
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 250 340 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 259 337 7.0E-19
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 256 337 1.0E-18
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 250 340 1.0E-17
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 250 340 1.0E-17
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 250 340 1.0E-17
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 250 340 1.0E-17
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 250 331 2.0E-17
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 250 321 2.0E-17
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 257 341 3.0E-17
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 246 331 4.0E-17
sp|Q8VCZ7|ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus GN=Zbtb7c PE=2 SV=1 250 333 4.0E-17
sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens GN=ZBTB7C PE=2 SV=1 250 333 4.0E-17
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 250 321 5.0E-17
sp|Q02035|KRUP_PSYCI Protein krueppel (Fragment) OS=Psychoda cinerea GN=Kr PE=3 SV=1 250 321 1.0E-16
sp|O14258|ACE2_SCHPO Metallothionein expression activator OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ace2 PE=3 SV=1 204 340 3.0E-16
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 259 348 3.0E-16
sp|O15156|ZBT7B_HUMAN Zinc finger and BTB domain-containing protein 7B OS=Homo sapiens GN=ZBTB7B PE=1 SV=2 250 334 4.0E-16
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 242 333 5.0E-16
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 255 337 5.0E-16
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 254 337 5.0E-16
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 255 333 5.0E-16
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 242 333 5.0E-16
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 255 337 6.0E-16
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 255 337 6.0E-16
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 255 337 6.0E-16
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 255 337 6.0E-16
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 255 337 6.0E-16
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 247 333 7.0E-16
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 259 348 8.0E-16
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 249 333 8.0E-16
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 247 333 9.0E-16
sp|P31507|KRUP_APIME Protein krueppel (Fragment) OS=Apis mellifera GN=Kr PE=3 SV=1 250 321 9.0E-16
sp|Q59SN6|CRZ2_CANAL Transcriptional regulator CRZ2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ2 PE=2 SV=1 259 345 1.0E-15
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 245 354 1.0E-15
sp|Q64321|ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus GN=Zbtb7b PE=1 SV=2 250 334 1.0E-15
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 252 385 2.0E-15
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 245 354 2.0E-15
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 255 358 3.0E-15
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 234 333 3.0E-15
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 234 333 3.0E-15
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 255 333 3.0E-15
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 250 318 3.0E-15
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 193 337 4.0E-15
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 236 333 5.0E-15
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 250 333 5.0E-15
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 236 333 6.0E-15
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 239 333 6.0E-15
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 6.0E-15
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 239 333 6.0E-15
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 252 333 7.0E-15
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 255 333 8.0E-15
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 260 333 9.0E-15
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 245 333 1.0E-14
sp|O35738|KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus GN=Klf12 PE=1 SV=2 248 333 1.0E-14
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 250 321 1.0E-14
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 245 333 1.0E-14
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 245 337 1.0E-14
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 248 333 1.0E-14
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 255 360 2.0E-14
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 255 360 2.0E-14
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 252 340 2.0E-14
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 252 336 2.0E-14
sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 PE=1 SV=3 220 333 2.0E-14
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 249 333 2.0E-14
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 249 333 2.0E-14
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 252 344 2.0E-14
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 180 333 2.0E-14
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 240 337 3.0E-14
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 180 340 3.0E-14
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 255 331 3.0E-14
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 251 333 3.0E-14
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 250 333 3.0E-14
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 252 340 3.0E-14
sp|Q9QZP2|PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus GN=Prdm4 PE=2 SV=1 252 337 3.0E-14
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 180 333 3.0E-14
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 251 333 3.0E-14
sp|Q80V63|PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus GN=Prdm4 PE=2 SV=2 252 337 3.0E-14
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 255 333 3.0E-14
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 260 333 4.0E-14
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 236 331 4.0E-14
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 252 331 4.0E-14
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 252 331 4.0E-14
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 245 333 5.0E-14
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 191 337 5.0E-14
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 236 353 5.0E-14
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 250 333 6.0E-14
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 252 333 6.0E-14
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 255 333 6.0E-14
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 191 337 6.0E-14
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 246 333 6.0E-14
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 252 333 6.0E-14
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 331 6.0E-14
sp|Q99JB0|KLF7_MOUSE Krueppel-like factor 7 OS=Mus musculus GN=Klf7 PE=2 SV=1 247 333 6.0E-14
sp|Q9Z0Z7|KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus GN=Klf5 PE=2 SV=2 246 333 6.0E-14
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 245 333 7.0E-14
sp|B1WBS3|ZBT42_RAT Zinc finger and BTB domain-containing protein 42 OS=Rattus norvegicus GN=Zbtb42 PE=2 SV=1 259 333 7.0E-14
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 252 333 8.0E-14
sp|Q811H0|ZBT42_MOUSE Zinc finger and BTB domain-containing protein 42 OS=Mus musculus GN=Zbtb42 PE=1 SV=2 259 333 8.0E-14
sp|O75840|KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens GN=KLF7 PE=2 SV=1 255 333 8.0E-14
sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens GN=KLF16 PE=1 SV=1 255 333 8.0E-14
sp|Q9JKY3|ZBT18_RAT Zinc finger and BTB domain-containing protein 18 OS=Rattus norvegicus GN=Zbtb18 PE=1 SV=1 259 333 8.0E-14
sp|A0JN76|ZBT18_BOVIN Zinc finger and BTB domain-containing protein 18 OS=Bos taurus GN=ZBTB18 PE=2 SV=2 259 333 8.0E-14
sp|Q99592|ZBT18_HUMAN Zinc finger and BTB domain-containing protein 18 OS=Homo sapiens GN=ZBTB18 PE=1 SV=1 259 333 8.0E-14
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 255 333 8.0E-14
sp|Q9WUK6|ZBT18_MOUSE Zinc finger and BTB domain-containing protein 18 OS=Mus musculus GN=Zbtb18 PE=1 SV=1 259 333 8.0E-14
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 9.0E-14
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 209 333 9.0E-14
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 233 332 9.0E-14
sp|Q5ZM39|BCL6_CHICK B-cell lymphoma 6 protein homolog OS=Gallus gallus GN=BCL6 PE=2 SV=1 191 337 9.0E-14
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 252 333 1.0E-13
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 252 333 1.0E-13
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 252 333 1.0E-13
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 252 333 1.0E-13
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 252 333 1.0E-13
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 253 333 1.0E-13
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 209 333 1.0E-13
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 240 333 1.0E-13
sp|Q7ZWZ4|ZB182_XENLA Zinc finger and BTB domain-containing protein 18.2 OS=Xenopus laevis GN=zbtb18.2 PE=2 SV=2 217 333 1.0E-13
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 214 333 1.0E-13
sp|B2RXF5|ZBT42_HUMAN Zinc finger and BTB domain-containing protein 42 OS=Homo sapiens GN=ZBTB42 PE=1 SV=2 180 333 1.0E-13
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 257 333 1.0E-13
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 252 337 1.0E-13
sp|Q1L8W0|ZBT18_DANRE Zinc finger and BTB domain-containing protein 18 OS=Danio rerio GN=zbtb18 PE=2 SV=1 259 333 1.0E-13
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 255 333 1.0E-13
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 257 333 1.0E-13
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 255 333 1.0E-13
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 252 337 1.0E-13
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 245 331 2.0E-13
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 246 337 2.0E-13
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 2.0E-13
sp|Q801P1|ZBT18_XENLA Zinc finger and BTB domain-containing protein 18 OS=Xenopus laevis GN=zbtb18 PE=2 SV=2 259 333 2.0E-13
sp|Q96CS4|ZN689_HUMAN Zinc finger protein 689 OS=Homo sapiens GN=ZNF689 PE=2 SV=1 250 337 2.0E-13
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 250 336 2.0E-13
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 250 333 2.0E-13
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 250 333 2.0E-13
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 245 337 2.0E-13
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 257 333 2.0E-13
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 252 343 3.0E-13
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 245 331 3.0E-13
sp|Q8BKK5|ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus GN=Znf689 PE=2 SV=1 250 337 3.0E-13
sp|Q59RR0|ACE2_CANAL Cell wall transcription factor ACE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACE2 PE=3 SV=1 234 340 3.0E-13
sp|Q99PJ7|ZN689_RAT Zinc finger protein 689 OS=Rattus norvegicus GN=Znf689 PE=2 SV=1 250 337 3.0E-13
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 238 333 3.0E-13
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 229 337 3.0E-13
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 3.0E-13
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 250 333 3.0E-13
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 224 333 3.0E-13
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 250 333 3.0E-13
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 250 337 3.0E-13
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 247 333 3.0E-13
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 247 333 3.0E-13
sp|Q80VM4|ZN579_MOUSE Zinc finger protein 579 OS=Mus musculus GN=Znf579 PE=1 SV=1 253 333 3.0E-13
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 236 337 3.0E-13
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 236 337 3.0E-13
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 3.0E-13
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 252 337 4.0E-13
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 252 337 4.0E-13
sp|Q9N658|GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster GN=sens PE=1 SV=1 254 337 4.0E-13
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 238 333 4.0E-13
sp|Q8NAF0|ZN579_HUMAN Zinc finger protein 579 OS=Homo sapiens GN=ZNF579 PE=1 SV=2 253 333 4.0E-13
sp|Q0IJ29|ZBT18_XENTR Zinc finger and BTB domain-containing protein 18 OS=Xenopus tropicalis GN=zbtb18 PE=2 SV=1 259 333 4.0E-13
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 245 337 4.0E-13
sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens GN=PRDM5 PE=1 SV=2 236 331 4.0E-13
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 236 333 5.0E-13
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 5.0E-13
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 250 333 5.0E-13
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 250 333 5.0E-13
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 252 331 5.0E-13
sp|Q8N143|BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens GN=BCL6B PE=2 SV=2 233 339 6.0E-13
sp|Q03081|MET31_YEAST Transcriptional regulator MET31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET31 PE=1 SV=1 239 354 6.0E-13
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 191 333 6.0E-13
sp|Q6NRM8|ZB183_XENLA Zinc finger and BTB domain-containing protein 18.3 OS=Xenopus laevis GN=zbtb18.3 PE=2 SV=1 259 333 6.0E-13
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 245 337 6.0E-13
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 236 331 6.0E-13
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 229 333 7.0E-13
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 229 333 7.0E-13
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 252 337 7.0E-13
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 252 331 7.0E-13
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 252 337 7.0E-13
sp|P18719|ZG32_XENLA Gastrula zinc finger protein XlCGF32.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 255 333 7.0E-13
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 257 333 7.0E-13
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 250 337 7.0E-13
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 245 337 8.0E-13
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 245 333 8.0E-13
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 333 8.0E-13
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 232 333 8.0E-13
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 255 333 8.0E-13
sp|O88282|BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus GN=Bcl6b PE=1 SV=1 233 339 8.0E-13
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 257 333 8.0E-13
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 255 333 8.0E-13
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 245 337 9.0E-13
sp|Q9QZP2|PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus GN=Prdm4 PE=2 SV=1 252 335 9.0E-13
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 257 333 9.0E-13
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 257 333 9.0E-13
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 278 331 1.0E-12
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 245 337 1.0E-12
sp|Q80V63|PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus GN=Prdm4 PE=2 SV=2 252 333 1.0E-12
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 252 331 1.0E-12
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 1.0E-12
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 1.0E-12
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 252 337 1.0E-12
sp|O88282|BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus GN=Bcl6b PE=1 SV=1 252 333 1.0E-12
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 246 337 1.0E-12
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 257 333 1.0E-12
sp|Q8TF68|ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens GN=ZNF384 PE=1 SV=2 12 337 1.0E-12
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 255 333 1.0E-12
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 245 337 1.0E-12
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 191 333 1.0E-12
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 257 333 1.0E-12
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 1.0E-12
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 245 337 1.0E-12
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 257 333 1.0E-12
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 257 333 1.0E-12
sp|P39413|AEF1_DROME Adult enhancer factor 1 OS=Drosophila melanogaster GN=Aef1 PE=2 SV=1 184 333 1.0E-12
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 214 337 1.0E-12
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 257 333 1.0E-12
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 257 333 1.0E-12
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 250 333 1.0E-12
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 248 333 1.0E-12
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 257 333 1.0E-12
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 246 337 1.0E-12
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 250 337 1.0E-12
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 158 332 1.0E-12
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 245 337 1.0E-12
sp|Q29419|ZFY_PIG Zinc finger Y-chromosomal protein (Fragment) OS=Sus scrofa GN=ZFY PE=3 SV=1 255 333 1.0E-12
sp|P80944|ZFX_PIG Zinc finger X-chromosomal protein (Fragment) OS=Sus scrofa GN=ZFX PE=3 SV=1 255 333 1.0E-12
sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens GN=ZBTB7C PE=2 SV=1 258 354 2.0E-12
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 253 337 2.0E-12
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 217 332 2.0E-12
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 250 337 2.0E-12
sp|Q9EQJ4|ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus GN=Znf384 PE=1 SV=1 224 337 2.0E-12
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 251 333 2.0E-12
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 251 333 2.0E-12
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 158 332 2.0E-12
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 257 333 2.0E-12
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 250 333 2.0E-12
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 251 333 2.0E-12
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 245 337 2.0E-12
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 245 331 2.0E-12
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 251 333 2.0E-12
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 257 347 2.0E-12
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 238 337 2.0E-12
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 238 331 2.0E-12
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 246 337 2.0E-12
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 255 337 2.0E-12
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 250 331 2.0E-12
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 255 337 2.0E-12
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 259 337 2.0E-12
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 259 333 2.0E-12
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 278 331 3.0E-12
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 337 3.0E-12
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 250 337 3.0E-12
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 252 333 3.0E-12
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 250 337 3.0E-12
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 236 333 3.0E-12
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 255 333 3.0E-12
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 255 337 3.0E-12
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 3.0E-12
sp|Q8BLM0|KLF8_MOUSE Krueppel-like factor 8 OS=Mus musculus GN=Klf8 PE=2 SV=1 255 333 3.0E-12
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 250 333 3.0E-12
sp|Q9H963|ZN702_HUMAN Putative zinc finger protein 702 OS=Homo sapiens GN=ZNF702P PE=5 SV=2 252 324 3.0E-12
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 158 333 3.0E-12
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 257 333 3.0E-12
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 255 337 3.0E-12
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 259 333 3.0E-12
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 252 337 3.0E-12
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 255 337 3.0E-12
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 245 337 3.0E-12
sp|A2AJ77|PRD12_MOUSE PR domain zinc finger protein 12 OS=Mus musculus GN=Prdm12 PE=2 SV=1 248 335 3.0E-12
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 250 333 3.0E-12
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 255 333 3.0E-12
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 250 331 3.0E-12
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 191 354 4.0E-12
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 258 333 4.0E-12
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 278 331 4.0E-12
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 253 349 4.0E-12
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 252 333 4.0E-12
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 252 333 4.0E-12
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 252 333 4.0E-12
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 252 333 4.0E-12
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 252 333 4.0E-12
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 252 333 4.0E-12
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 252 333 4.0E-12
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 252 337 4.0E-12
sp|Q66K89|E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens GN=E4F1 PE=1 SV=2 259 338 4.0E-12
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 259 337 4.0E-12
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 236 333 4.0E-12
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 238 331 4.0E-12
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 255 333 4.0E-12
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 252 332 4.0E-12
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 246 333 4.0E-12
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 206 333 4.0E-12
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 259 337 4.0E-12
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 206 333 4.0E-12
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 253 337 4.0E-12
sp|Q8VCZ7|ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus GN=Zbtb7c PE=2 SV=1 258 354 5.0E-12
sp|Q02035|KRUP_PSYCI Protein krueppel (Fragment) OS=Psychoda cinerea GN=Kr PE=3 SV=1 278 331 5.0E-12
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 253 349 5.0E-12
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 331 5.0E-12
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 206 333 5.0E-12
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 245 333 5.0E-12
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 259 337 5.0E-12
sp|P08153|SWI5_YEAST Transcriptional factor SWI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI5 PE=1 SV=1 255 340 5.0E-12
sp|P70338|GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus GN=Gfi1 PE=1 SV=2 259 333 5.0E-12
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 262 333 5.0E-12
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 245 331 5.0E-12
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 259 337 5.0E-12
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 238 331 5.0E-12
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 250 333 5.0E-12
sp|Q5DWN0|GFI1_CANLF Zinc finger protein Gfi-1 OS=Canis lupus familiaris GN=GFI1 PE=2 SV=1 259 333 5.0E-12
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 5.0E-12
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 246 333 5.0E-12
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 258 333 6.0E-12
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 6.0E-12
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 337 6.0E-12
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 245 333 6.0E-12
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 236 332 6.0E-12
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 238 331 6.0E-12
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 238 331 6.0E-12
sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 259 338 6.0E-12
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 245 337 6.0E-12
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 257 337 6.0E-12
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 238 331 6.0E-12
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 252 332 6.0E-12
sp|P31507|KRUP_APIME Protein krueppel (Fragment) OS=Apis mellifera GN=Kr PE=3 SV=1 278 331 7.0E-12
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 278 331 7.0E-12
sp|P18740|ZO14_XENLA Oocyte zinc finger protein XlCOF14 (Fragment) OS=Xenopus laevis PE=3 SV=1 236 331 7.0E-12
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 236 337 7.0E-12
sp|Q3B7M4|ZN746_BOVIN Zinc finger protein 746 OS=Bos taurus GN=ZNF746 PE=2 SV=1 243 333 7.0E-12
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 255 333 7.0E-12
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 255 333 7.0E-12
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 252 331 7.0E-12
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 331 8.0E-12
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 8.0E-12
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 8.0E-12
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 252 348 8.0E-12
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 245 337 8.0E-12
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 8.0E-12
sp|Q9H963|ZN702_HUMAN Putative zinc finger protein 702 OS=Homo sapiens GN=ZNF702P PE=5 SV=2 253 333 8.0E-12
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 252 337 8.0E-12
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 9.0E-12
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 248 333 9.0E-12
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 250 333 9.0E-12
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 252 333 9.0E-12
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 1.0E-11
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 258 333 1.0E-11
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 245 337 1.0E-11
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 236 337 1.0E-11
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 253 333 1.0E-11
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 256 337 1.0E-11
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 142 337 1.0E-11
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 252 339 1.0E-11
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 245 333 1.0E-11
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 252 336 1.0E-11
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 255 355 1.0E-11
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 239 337 1.0E-11
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 239 337 1.0E-11
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 236 337 1.0E-11
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 250 337 1.0E-11
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 246 333 1.0E-11
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 238 331 1.0E-11
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 252 337 1.0E-11
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 252 337 1.0E-11
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 236 337 1.0E-11
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 236 337 1.0E-11
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 245 337 1.0E-11
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 245 337 1.0E-11
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 245 337 1.0E-11
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 245 337 1.0E-11
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 208 337 1.0E-11
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 245 337 1.0E-11
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 252 337 1.0E-11
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 232 337 1.0E-11
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 262 333 1.0E-11
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 233 337 1.0E-11
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 232 337 1.0E-11
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 259 343 1.0E-11
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 252 337 1.0E-11
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 262 333 1.0E-11
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 252 331 1.0E-11
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 250 322 1.0E-11
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 252 337 1.0E-11
sp|Q6DCW1|GFI1B_XENLA Zinc finger protein Gfi-1b OS=Xenopus laevis GN=gfi1b PE=2 SV=1 259 337 1.0E-11
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 252 331 1.0E-11
sp|Q9H4Q4|PRD12_HUMAN PR domain zinc finger protein 12 OS=Homo sapiens GN=PRDM12 PE=1 SV=2 256 335 1.0E-11
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 252 333 1.0E-11
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 259 331 1.0E-11
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 250 337 2.0E-11
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 250 337 2.0E-11
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 250 331 2.0E-11
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 259 337 2.0E-11
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 2.0E-11
sp|Q96CS4|ZN689_HUMAN Zinc finger protein 689 OS=Homo sapiens GN=ZNF689 PE=2 SV=1 252 331 2.0E-11
sp|Q8BKK5|ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus GN=Znf689 PE=2 SV=1 252 331 2.0E-11
sp|Q99PJ7|ZN689_RAT Zinc finger protein 689 OS=Rattus norvegicus GN=Znf689 PE=2 SV=1 252 331 2.0E-11
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 255 354 2.0E-11
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 252 337 2.0E-11
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 255 337 2.0E-11
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 245 333 2.0E-11
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 245 333 2.0E-11
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 214 333 2.0E-11
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 216 331 2.0E-11
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 246 337 2.0E-11
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 236 337 2.0E-11
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 236 333 2.0E-11
sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens GN=ZNF362 PE=1 SV=1 237 333 2.0E-11
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 252 333 2.0E-11
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 243 333 2.0E-11
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 161 337 2.0E-11
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 255 331 2.0E-11
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 259 331 2.0E-11
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 236 337 2.0E-11
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 262 333 2.0E-11
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 262 333 2.0E-11
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 262 333 2.0E-11
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 251 331 2.0E-11
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 250 337 2.0E-11
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 251 331 2.0E-11
sp|Q96LX8|ZN597_HUMAN Zinc finger protein 597 OS=Homo sapiens GN=ZNF597 PE=2 SV=1 230 412 2.0E-11
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 193 337 2.0E-11
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 245 337 2.0E-11
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 232 337 2.0E-11
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 245 337 2.0E-11
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 245 333 2.0E-11
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 250 331 2.0E-11
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 232 337 2.0E-11
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 181 337 2.0E-11
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 236 337 2.0E-11
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 250 337 2.0E-11
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 236 337 2.0E-11
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 245 331 2.0E-11
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 251 331 2.0E-11
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 245 337 3.0E-11
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 331 3.0E-11
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 250 333 3.0E-11
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 224 333 3.0E-11
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 3.0E-11
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 250 337 3.0E-11
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 245 337 3.0E-11
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 234 337 3.0E-11
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 243 337 3.0E-11
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 252 331 3.0E-11
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 250 337 3.0E-11
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 245 337 3.0E-11
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 245 337 3.0E-11
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 252 337 3.0E-11
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 253 333 3.0E-11
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 245 333 3.0E-11
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 252 337 3.0E-11
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 245 337 3.0E-11
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 236 337 3.0E-11
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 251 331 3.0E-11
sp|Q9D0B1|ZN524_MOUSE Zinc finger protein 524 OS=Mus musculus GN=Znf524 PE=2 SV=1 255 333 3.0E-11
sp|Q6NUN9|ZN746_HUMAN Zinc finger protein 746 OS=Homo sapiens GN=ZNF746 PE=1 SV=1 254 333 3.0E-11
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 245 337 3.0E-11
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 252 331 3.0E-11
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 262 333 3.0E-11
sp|Q96C55|ZN524_HUMAN Zinc finger protein 524 OS=Homo sapiens GN=ZNF524 PE=1 SV=1 255 333 3.0E-11
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 250 332 3.0E-11
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 232 337 3.0E-11
sp|Q5XJQ7|OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio GN=osr1 PE=2 SV=1 193 331 3.0E-11
sp|Q3U133|ZN746_MOUSE Zinc finger protein 746 OS=Mus musculus GN=Znf746 PE=1 SV=3 258 333 3.0E-11
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 252 337 3.0E-11
sp|A8K8V0|ZN785_HUMAN Zinc finger protein 785 OS=Homo sapiens GN=ZNF785 PE=1 SV=1 245 349 3.0E-11
sp|B0K011|OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus GN=Osr1 PE=2 SV=1 255 331 3.0E-11
sp|Q9WVG7|OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus GN=Osr1 PE=2 SV=1 255 331 3.0E-11
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 232 337 3.0E-11
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 262 333 3.0E-11
sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 253 331 3.0E-11
sp|Q96CS4|ZN689_HUMAN Zinc finger protein 689 OS=Homo sapiens GN=ZNF689 PE=2 SV=1 259 337 4.0E-11
sp|Q8BKK5|ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus GN=Znf689 PE=2 SV=1 259 337 4.0E-11
sp|Q99PJ7|ZN689_RAT Zinc finger protein 689 OS=Rattus norvegicus GN=Znf689 PE=2 SV=1 259 337 4.0E-11
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 245 337 4.0E-11
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 234 337 4.0E-11
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 236 337 4.0E-11
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 250 337 4.0E-11
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 245 337 4.0E-11
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 251 337 4.0E-11
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 252 337 4.0E-11
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 252 337 4.0E-11
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 236 337 4.0E-11
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 252 337 4.0E-11
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 253 333 4.0E-11
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 252 337 4.0E-11
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 236 337 4.0E-11
sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 253 331 4.0E-11
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 262 333 4.0E-11
sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 253 331 4.0E-11
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 250 333 4.0E-11
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 236 333 4.0E-11
sp|Q8N8C0|ZN781_HUMAN Zinc finger protein 781 OS=Homo sapiens GN=ZNF781 PE=2 SV=1 246 323 4.0E-11
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 252 337 4.0E-11
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 252 337 4.0E-11
sp|Q8TF68|ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens GN=ZNF384 PE=1 SV=2 255 333 5.0E-11
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 236 333 5.0E-11
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 259 333 5.0E-11
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 232 333 5.0E-11
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 236 333 5.0E-11
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 236 337 5.0E-11
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 236 337 5.0E-11
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 236 338 5.0E-11
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 245 337 5.0E-11
sp|P57071|PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens GN=PRDM15 PE=2 SV=4 202 337 5.0E-11
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 236 333 5.0E-11
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 236 337 5.0E-11
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 236 337 5.0E-11
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 252 337 5.0E-11
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 253 331 5.0E-11
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 252 337 5.0E-11
sp|Q9ESX2|SP6_MOUSE Transcription factor Sp6 OS=Mus musculus GN=Sp6 PE=2 SV=2 253 333 5.0E-11
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 252 331 6.0E-11
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 205 333 6.0E-11
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 252 333 6.0E-11
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 245 337 6.0E-11
sp|Q9EQJ4|ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus GN=Znf384 PE=1 SV=1 255 333 6.0E-11
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 234 337 6.0E-11
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 250 337 6.0E-11
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 250 347 6.0E-11
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 250 333 6.0E-11
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 252 333 6.0E-11
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 232 333 6.0E-11
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 232 337 6.0E-11
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 250 337 6.0E-11
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 253 337 6.0E-11
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 255 336 6.0E-11
sp|Q6AY34|OSR2_RAT Protein odd-skipped-related 2 OS=Rattus norvegicus GN=Osr2 PE=2 SV=1 251 331 6.0E-11
sp|Q3T135|OSR2_BOVIN Protein odd-skipped-related 2 OS=Bos taurus GN=OSR2 PE=2 SV=1 251 331 6.0E-11
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 236 337 6.0E-11
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 252 337 6.0E-11
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 192 337 6.0E-11
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 230 337 6.0E-11
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 247 333 6.0E-11
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 245 337 6.0E-11
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 253 337 6.0E-11
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 250 331 6.0E-11
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 251 333 6.0E-11
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 250 333 6.0E-11
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 252 333 6.0E-11
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 240 331 6.0E-11
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 245 340 7.0E-11
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 275 337 7.0E-11
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 236 337 7.0E-11
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 236 333 7.0E-11
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 253 337 7.0E-11
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 252 333 7.0E-11
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 250 337 7.0E-11
sp|Q86UZ6|ZBT46_HUMAN Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens GN=ZBTB46 PE=1 SV=2 255 341 7.0E-11
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 250 333 7.0E-11
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 245 337 7.0E-11
sp|Q66JF8|OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis GN=osr1 PE=2 SV=1 182 331 7.0E-11
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 252 333 7.0E-11
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 254 333 7.0E-11
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 250 337 7.0E-11
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 230 337 7.0E-11
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 252 438 7.0E-11
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 229 337 8.0E-11
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 259 337 8.0E-11
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 245 337 8.0E-11
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 250 333 8.0E-11
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 249 347 8.0E-11
sp|A8K8V0|ZN785_HUMAN Zinc finger protein 785 OS=Homo sapiens GN=ZNF785 PE=1 SV=1 252 333 8.0E-11
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 255 349 8.0E-11
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 236 337 8.0E-11
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 231 337 8.0E-11
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 259 337 8.0E-11
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 252 333 8.0E-11
sp|Q8N895|ZN366_HUMAN Zinc finger protein 366 OS=Homo sapiens GN=ZNF366 PE=1 SV=1 216 341 8.0E-11
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 250 336 8.0E-11
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 250 333 9.0E-11
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 245 333 9.0E-11
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 239 333 9.0E-11
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 239 333 9.0E-11
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 257 337 9.0E-11
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 236 333 9.0E-11
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 243 333 9.0E-11
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 195 337 9.0E-11
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 252 333 9.0E-11
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 245 333 9.0E-11
sp|Q567J8|OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio GN=osr2 PE=2 SV=1 255 349 9.0E-11
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 259 337 9.0E-11
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 250 337 1.0E-10
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 250 333 1.0E-10
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 250 333 1.0E-10
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 252 333 1.0E-10
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 245 333 1.0E-10
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 157 333 1.0E-10
sp|Q9QZP2|PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus GN=Prdm4 PE=2 SV=1 233 331 1.0E-10
sp|Q80V63|PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus GN=Prdm4 PE=2 SV=2 233 331 1.0E-10
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 258 337 1.0E-10
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 1.0E-10
sp|Q96CS4|ZN689_HUMAN Zinc finger protein 689 OS=Homo sapiens GN=ZNF689 PE=2 SV=1 236 331 1.0E-10
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 245 337 1.0E-10
sp|Q8BKK5|ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus GN=Znf689 PE=2 SV=1 236 331 1.0E-10
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 232 337 1.0E-10
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 337 1.0E-10
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 252 338 1.0E-10
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 229 337 1.0E-10
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 234 337 1.0E-10
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 245 337 1.0E-10
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 255 349 1.0E-10
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 253 337 1.0E-10
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 252 333 1.0E-10
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 245 337 1.0E-10
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 210 337 1.0E-10
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 252 331 1.0E-10
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 229 337 1.0E-10
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 229 337 1.0E-10
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 229 337 1.0E-10
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 250 337 1.0E-10
sp|A8K8V0|ZN785_HUMAN Zinc finger protein 785 OS=Homo sapiens GN=ZNF785 PE=1 SV=1 257 337 1.0E-10
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 250 337 1.0E-10
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 250 337 1.0E-10
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 247 333 1.0E-10
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 250 337 1.0E-10
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 236 333 1.0E-10
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 250 333 1.0E-10
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 236 337 1.0E-10
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 250 337 1.0E-10
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 250 336 1.0E-10
sp|Q15697|ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens GN=ZNF174 PE=1 SV=1 249 337 1.0E-10
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 255 331 1.0E-10
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 245 337 1.0E-10
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 245 337 1.0E-10
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 252 331 1.0E-10
sp|Q8N2I2|ZN619_HUMAN Zinc finger protein 619 OS=Homo sapiens GN=ZNF619 PE=2 SV=1 257 337 1.0E-10
sp|Q8BID6|ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus GN=Zbtb46 PE=1 SV=2 255 341 1.0E-10
sp|Q08876|SUHW_DROVI Protein suppressor of hairy wing OS=Drosophila virilis GN=su(Hw) PE=2 SV=1 256 337 1.0E-10
sp|Q08876|SUHW_DROVI Protein suppressor of hairy wing OS=Drosophila virilis GN=su(Hw) PE=2 SV=1 250 333 1.0E-10
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 229 337 1.0E-10
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 250 333 1.0E-10
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 259 337 1.0E-10
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 236 337 1.0E-10
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 244 337 1.0E-10
sp|Q9ULM2|ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens GN=ZNF490 PE=1 SV=2 213 337 1.0E-10
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 245 337 1.0E-10
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 252 333 1.0E-10
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 250 331 1.0E-10
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 236 331 1.0E-10
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 1.0E-10
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 245 337 1.0E-10
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 259 337 1.0E-10
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 251 333 1.0E-10
sp|P86413|OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis GN=osr1 PE=2 SV=1 251 331 1.0E-10
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 255 331 1.0E-10
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 252 337 1.0E-10
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 252 336 1.0E-10
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 245 337 1.0E-10
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 246 337 1.0E-10
sp|Q9VQS7|SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster GN=sob PE=2 SV=1 255 331 1.0E-10
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 233 337 1.0E-10
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 252 337 1.0E-10
sp|C7EMF5|KLF17_PIG Krueppel-like factor 17 OS=Sus scrofa GN=KLF17 PE=2 SV=1 255 333 1.0E-10
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 250 333 1.0E-10
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 239 337 1.0E-10
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 200 337 1.0E-10
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 245 333 1.0E-10
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 205 333 2.0E-10
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 250 333 2.0E-10
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 250 333 2.0E-10
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 233 331 2.0E-10
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 233 331 2.0E-10
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 98 333 2.0E-10
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 331 2.0E-10
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 236 337 2.0E-10
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 236 337 2.0E-10
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 245 333 2.0E-10
sp|Q99PJ7|ZN689_RAT Zinc finger protein 689 OS=Rattus norvegicus GN=Znf689 PE=2 SV=1 236 331 2.0E-10
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 234 333 2.0E-10
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 259 337 2.0E-10
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 252 337 2.0E-10
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 239 333 2.0E-10
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 255 349 2.0E-10
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 250 333 2.0E-10
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 252 333 2.0E-10
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 250 337 2.0E-10
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 252 331 2.0E-10
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 252 331 2.0E-10
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 252 331 2.0E-10
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 252 333 2.0E-10
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 245 337 2.0E-10
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 217 337 2.0E-10
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 236 333 2.0E-10
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 252 333 2.0E-10
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 250 347 2.0E-10
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 259 354 2.0E-10
sp|Q96C55|ZN524_HUMAN Zinc finger protein 524 OS=Homo sapiens GN=ZNF524 PE=1 SV=1 249 337 2.0E-10
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 245 337 2.0E-10
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 236 333 2.0E-10
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 241 336 2.0E-10
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 252 332 2.0E-10
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 250 333 2.0E-10
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 252 337 2.0E-10
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 232 354 2.0E-10
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 245 331 2.0E-10
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 230 333 2.0E-10
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 236 331 2.0E-10
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 250 337 2.0E-10
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 236 337 2.0E-10
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 245 337 2.0E-10
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 252 337 2.0E-10
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 250 333 2.0E-10
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 246 337 2.0E-10
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 252 337 2.0E-10
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 211 333 2.0E-10
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 245 333 2.0E-10
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 259 333 2.0E-10
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 252 337 2.0E-10
sp|Q8NAM6|ZSCA4_HUMAN Zinc finger and SCAN domain-containing protein 4 OS=Homo sapiens GN=ZSCAN4 PE=2 SV=1 255 333 2.0E-10
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 252 367 2.0E-10
sp|Q9WTJ4|FIZ1_MOUSE Flt3-interacting zinc finger protein 1 OS=Mus musculus GN=Fiz1 PE=1 SV=1 252 333 2.0E-10
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 252 331 2.0E-10
sp|P41995|ODD1_CAEEL Zinc finger protein odd-1 OS=Caenorhabditis elegans GN=odd-1 PE=2 SV=2 255 331 2.0E-10
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 250 337 2.0E-10
sp|A2T7G6|ZSCA4_PONPY Zinc finger and SCAN domain-containing protein 4 OS=Pongo pygmaeus GN=ZSCAN4 PE=3 SV=1 255 333 2.0E-10
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 252 333 2.0E-10
sp|P08970|SUHW_DROME Protein suppressor of hairy wing OS=Drosophila melanogaster GN=su(Hw) PE=1 SV=2 256 337 2.0E-10
sp|P08970|SUHW_DROME Protein suppressor of hairy wing OS=Drosophila melanogaster GN=su(Hw) PE=1 SV=2 250 333 2.0E-10
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 237 337 2.0E-10
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 252 337 2.0E-10
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 252 333 2.0E-10
sp|A1YFX5|ZSCA4_PANPA Zinc finger and SCAN domain-containing protein 4 OS=Pan paniscus GN=ZSCAN4 PE=3 SV=1 255 333 2.0E-10
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 230 337 2.0E-10
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 246 331 2.0E-10
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 252 337 2.0E-10
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 252 337 2.0E-10
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 252 337 2.0E-10
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 252 337 2.0E-10
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 245 337 2.0E-10
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 337 2.0E-10
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 250 337 2.0E-10
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 250 331 2.0E-10
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 252 337 2.0E-10
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 250 331 2.0E-10
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 257 337 2.0E-10
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 250 333 2.0E-10
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 253 333 2.0E-10
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 236 337 2.0E-10
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 252 333 2.0E-10
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 245 337 2.0E-10
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 252 331 2.0E-10
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 236 337 2.0E-10
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 250 333 3.0E-10
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 250 331 3.0E-10
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 250 331 3.0E-10
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 250 333 3.0E-10
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 245 331 3.0E-10
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 245 337 3.0E-10
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 252 337 3.0E-10
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 246 331 3.0E-10
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 246 337 3.0E-10
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 253 331 3.0E-10
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 236 333 3.0E-10
sp|Q8N895|ZN366_HUMAN Zinc finger protein 366 OS=Homo sapiens GN=ZNF366 PE=1 SV=1 236 358 3.0E-10
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 252 333 3.0E-10
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 245 333 3.0E-10
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 252 337 3.0E-10
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 236 331 3.0E-10
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 245 337 3.0E-10
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 259 337 3.0E-10
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 245 337 3.0E-10
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 245 337 4.0E-10
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 210 331 4.0E-10
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 236 337 4.0E-10
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 253 337 4.0E-10
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 252 337 4.0E-10
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 245 337 4.0E-10
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 250 337 4.0E-10
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 245 337 4.0E-10
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 259 337 4.0E-10
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 250 337 4.0E-10
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 255 337 4.0E-10
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 255 337 4.0E-10
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 252 337 4.0E-10
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 236 331 4.0E-10
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 245 333 4.0E-10
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 264 331 5.0E-10
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 252 333 5.0E-10
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 259 333 5.0E-10
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 259 333 5.0E-10
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 252 349 5.0E-10
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 252 337 5.0E-10
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 252 337 5.0E-10
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 250 333 5.0E-10
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 245 337 5.0E-10
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 236 337 5.0E-10
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 236 337 5.0E-10
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 229 337 5.0E-10
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 252 333 5.0E-10
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 337 5.0E-10
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 245 337 5.0E-10
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 252 337 5.0E-10
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 252 333 5.0E-10
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 246 337 5.0E-10
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 236 337 5.0E-10
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 255 337 5.0E-10
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 255 337 5.0E-10
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 181 333 5.0E-10
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 250 337 5.0E-10
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 252 337 5.0E-10
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 236 337 5.0E-10
sp|A2T7G6|ZSCA4_PONPY Zinc finger and SCAN domain-containing protein 4 OS=Pongo pygmaeus GN=ZSCAN4 PE=3 SV=1 215 337 5.0E-10
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 236 333 5.0E-10
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 252 331 6.0E-10
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 250 333 6.0E-10
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 252 333 6.0E-10
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 256 341 6.0E-10
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 252 332 6.0E-10
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 236 337 6.0E-10
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 245 363 6.0E-10
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 337 6.0E-10
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 250 333 6.0E-10
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 246 333 6.0E-10
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 250 331 6.0E-10
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 250 333 6.0E-10
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 161 333 6.0E-10
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 246 337 6.0E-10
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 236 333 6.0E-10
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 236 333 6.0E-10
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 245 337 6.0E-10
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 245 337 6.0E-10
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 252 333 6.0E-10
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 245 333 6.0E-10
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 245 337 6.0E-10
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 259 337 6.0E-10
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 245 337 6.0E-10
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 7.0E-10
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 229 337 7.0E-10
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 259 333 7.0E-10
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 255 337 7.0E-10
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 252 322 7.0E-10
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 245 358 7.0E-10
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 252 337 7.0E-10
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 252 333 7.0E-10
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 236 333 7.0E-10
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 236 331 7.0E-10
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 250 331 7.0E-10
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 250 331 7.0E-10
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 337 7.0E-10
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 252 333 7.0E-10
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 236 337 7.0E-10
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 245 333 7.0E-10
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 245 337 8.0E-10
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 245 331 8.0E-10
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 253 337 8.0E-10
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 233 333 8.0E-10
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 233 333 8.0E-10
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 250 337 8.0E-10
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 245 358 8.0E-10
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 236 337 8.0E-10
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 245 337 8.0E-10
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 245 337 8.0E-10
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 245 337 8.0E-10
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 245 333 8.0E-10
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 250 333 8.0E-10
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 236 337 8.0E-10
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 245 337 8.0E-10
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 252 511 8.0E-10
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 258 331 8.0E-10
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 252 331 8.0E-10
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 252 337 8.0E-10
sp|Q8NAM6|ZSCA4_HUMAN Zinc finger and SCAN domain-containing protein 4 OS=Homo sapiens GN=ZSCAN4 PE=2 SV=1 215 337 8.0E-10
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 245 337 8.0E-10
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 255 337 9.0E-10
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 253 337 9.0E-10
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 252 337 9.0E-10
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 245 337 9.0E-10
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 250 337 9.0E-10
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 236 337 9.0E-10
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 252 331 9.0E-10
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 9.0E-10
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 245 331 1.0E-09
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 252 333 1.0E-09
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 252 337 1.0E-09
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 252 333 1.0E-09
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 221 333 1.0E-09
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 252 337 1.0E-09
sp|Q66K89|E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens GN=E4F1 PE=1 SV=2 256 338 1.0E-09
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 252 331 1.0E-09
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 229 337 1.0E-09
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 259 337 1.0E-09
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 245 337 1.0E-09
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 252 342 1.0E-09
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 236 333 1.0E-09
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 245 337 1.0E-09
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 217 337 1.0E-09
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 245 337 1.0E-09
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 245 333 1.0E-09
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 252 373 1.0E-09
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 246 337 1.0E-09
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 259 337 1.0E-09
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 230 333 1.0E-09
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 252 380 1.0E-09
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 252 337 1.0E-09
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 245 337 1.0E-09
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 245 337 1.0E-09
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 252 337 1.0E-09
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 245 337 1.0E-09
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 246 337 1.0E-09
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 252 337 1.0E-09
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 245 337 1.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 259 337 1.0E-09
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 252 333 1.0E-09
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 252 331 1.0E-09
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 252 331 1.0E-09
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 250 337 1.0E-09
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 259 337 1.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 245 337 1.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 252 331 1.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 245 333 1.0E-09
sp|Q8N895|ZN366_HUMAN Zinc finger protein 366 OS=Homo sapiens GN=ZNF366 PE=1 SV=1 250 331 1.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 245 333 1.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 245 337 1.0E-09
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 250 331 1.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 245 337 1.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 252 331 1.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 245 333 1.0E-09
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 245 337 1.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 245 337 1.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 252 331 1.0E-09
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 229 337 1.0E-09
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 250 337 1.0E-09
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 259 333 1.0E-09
sp|A1YFX5|ZSCA4_PANPA Zinc finger and SCAN domain-containing protein 4 OS=Pan paniscus GN=ZSCAN4 PE=3 SV=1 215 337 1.0E-09
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 250 331 1.0E-09
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 258 337 1.0E-09
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 252 333 2.0E-09
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 229 337 2.0E-09
sp|Q96CS4|ZN689_HUMAN Zinc finger protein 689 OS=Homo sapiens GN=ZNF689 PE=2 SV=1 229 337 2.0E-09
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 2.0E-09
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 252 333 2.0E-09
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 252 333 2.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 242 337 2.0E-09
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 252 333 2.0E-09
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 252 333 2.0E-09
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 250 333 2.0E-09
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 252 333 2.0E-09
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 250 331 2.0E-09
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 250 331 2.0E-09
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 250 331 2.0E-09
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 245 337 2.0E-09
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 245 337 2.0E-09
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 250 331 2.0E-09
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 252 333 2.0E-09
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 243 333 2.0E-09
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 252 349 2.0E-09
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 246 337 2.0E-09
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 250 337 2.0E-09
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 252 337 2.0E-09
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 246 337 2.0E-09
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 228 333 2.0E-09
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 252 331 2.0E-09
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 239 333 2.0E-09
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 239 333 2.0E-09
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 185 337 2.0E-09
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 250 331 2.0E-09
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 250 331 2.0E-09
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 252 337 2.0E-09
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 245 337 2.0E-09
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 250 331 2.0E-09
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 250 337 2.0E-09
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 252 333 2.0E-09
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 252 333 2.0E-09
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 252 337 2.0E-09
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 245 337 2.0E-09
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 245 337 2.0E-09
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 251 333 2.0E-09
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 245 337 2.0E-09
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 252 337 2.0E-09
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 245 333 2.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 181 354 2.0E-09
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 259 337 2.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 245 333 2.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 245 337 2.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 245 333 2.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 245 337 2.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 245 333 2.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 245 337 2.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 245 333 2.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 245 333 2.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 245 337 2.0E-09
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 252 337 2.0E-09
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 236 337 2.0E-09
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 245 337 2.0E-09
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 250 337 2.0E-09
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 252 337 2.0E-09
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 245 337 2.0E-09
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 252 337 2.0E-09
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 246 337 2.0E-09
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 3.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 226 337 3.0E-09
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 252 337 3.0E-09
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 250 333 3.0E-09
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 246 337 3.0E-09
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 250 337 3.0E-09
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 236 337 3.0E-09
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 337 3.0E-09
sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 256 341 3.0E-09
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 233 333 3.0E-09
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 245 337 3.0E-09
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 236 337 3.0E-09
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 253 337 3.0E-09
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 250 333 3.0E-09
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 236 337 3.0E-09
sp|Q96LX8|ZN597_HUMAN Zinc finger protein 597 OS=Homo sapiens GN=ZNF597 PE=2 SV=1 244 331 3.0E-09
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 252 337 3.0E-09
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 245 331 3.0E-09
sp|A8K8V0|ZN785_HUMAN Zinc finger protein 785 OS=Homo sapiens GN=ZNF785 PE=1 SV=1 250 337 3.0E-09
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 252 337 3.0E-09
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 252 337 3.0E-09
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 252 331 3.0E-09
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 252 333 3.0E-09
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 216 358 3.0E-09
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 282 331 3.0E-09
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 252 337 3.0E-09
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 257 337 3.0E-09
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 250 333 3.0E-09
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 253 333 3.0E-09
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 236 337 3.0E-09
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 252 337 3.0E-09
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 245 337 3.0E-09
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 252 337 3.0E-09
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 255 333 3.0E-09
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 245 337 3.0E-09
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 245 337 3.0E-09
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 259 337 3.0E-09
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 252 331 3.0E-09
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 252 337 3.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 252 337 4.0E-09
sp|Q99PJ7|ZN689_RAT Zinc finger protein 689 OS=Rattus norvegicus GN=Znf689 PE=2 SV=1 200 337 4.0E-09
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 259 347 4.0E-09
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 252 333 4.0E-09
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 246 331 4.0E-09
sp|P18740|ZO14_XENLA Oocyte zinc finger protein XlCOF14 (Fragment) OS=Xenopus laevis PE=3 SV=1 254 331 4.0E-09
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 252 337 4.0E-09
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 262 333 4.0E-09
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 250 333 4.0E-09
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 258 337 4.0E-09
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 252 337 4.0E-09
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 243 333 4.0E-09
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 252 333 4.0E-09
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 243 333 4.0E-09
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 252 333 4.0E-09
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 236 333 4.0E-09
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 250 374 4.0E-09
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 245 354 4.0E-09
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 246 331 4.0E-09
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 337 4.0E-09
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 236 331 4.0E-09
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 253 337 4.0E-09
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 245 333 4.0E-09
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 252 337 4.0E-09
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 236 331 4.0E-09
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 245 337 4.0E-09
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 245 333 4.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 258 333 5.0E-09
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 234 337 5.0E-09
sp|Q8BKK5|ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus GN=Znf689 PE=2 SV=1 229 337 5.0E-09
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 259 337 5.0E-09
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 233 331 5.0E-09
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 250 337 5.0E-09
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 252 331 5.0E-09
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 252 331 5.0E-09
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 236 337 5.0E-09
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 236 354 5.0E-09
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 245 337 5.0E-09
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 250 333 5.0E-09
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 252 337 5.0E-09
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 252 337 5.0E-09
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 249 347 5.0E-09
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 252 337 5.0E-09
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 250 337 5.0E-09
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 252 336 5.0E-09
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 333 5.0E-09
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 245 337 5.0E-09
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 245 333 5.0E-09
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 245 333 5.0E-09
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 250 337 5.0E-09
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 245 333 5.0E-09
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 250 337 5.0E-09
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 252 337 5.0E-09
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 245 333 5.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 252 337 6.0E-09
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 262 337 6.0E-09
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 259 337 6.0E-09
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 259 337 6.0E-09
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 246 337 6.0E-09
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 236 333 6.0E-09
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 250 337 6.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 236 337 6.0E-09
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 250 374 6.0E-09
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 252 337 6.0E-09
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 245 337 6.0E-09
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 229 337 6.0E-09
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 245 337 6.0E-09
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 250 333 6.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 258 333 7.0E-09
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 252 337 7.0E-09
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 245 331 7.0E-09
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 250 337 7.0E-09
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 236 333 7.0E-09
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 236 337 7.0E-09
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 248 333 7.0E-09
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 266 333 7.0E-09
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 266 333 7.0E-09
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 252 337 7.0E-09
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 237 331 7.0E-09
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 250 337 7.0E-09
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 253 333 7.0E-09
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 245 337 7.0E-09
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 252 333 8.0E-09
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 245 345 8.0E-09
sp|Q9N658|GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster GN=sens PE=1 SV=1 259 331 8.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 250 337 8.0E-09
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 245 337 8.0E-09
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 253 337 8.0E-09
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 157 337 8.0E-09
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 245 337 8.0E-09
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 236 337 8.0E-09
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 252 340 8.0E-09
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 250 337 8.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 246 337 8.0E-09
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 252 331 8.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 181 333 8.0E-09
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 257 307 8.0E-09
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 252 337 8.0E-09
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 259 333 8.0E-09
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 252 337 9.0E-09
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 259 337 9.0E-09
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 259 337 9.0E-09
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 257 337 9.0E-09
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 252 337 9.0E-09
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 331 9.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 245 337 9.0E-09
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 236 337 9.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 181 333 9.0E-09
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 252 337 9.0E-09
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 250 331 9.0E-09
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 245 337 9.0E-09
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 232 333 9.0E-09
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 252 331 1.0E-08
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 259 337 1.0E-08
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 262 333 1.0E-08
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 245 337 1.0E-08
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 203 337 1.0E-08
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 260 337 1.0E-08
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 253 337 1.0E-08
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 282 337 1.0E-08
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 224 337 1.0E-08
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 253 333 1.0E-08
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 252 333 1.0E-08
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 230 337 1.0E-08
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 245 333 1.0E-08
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 255 337 1.0E-08
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 252 333 1.0E-08
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 252 333 1.0E-08
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 252 337 1.0E-08
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 250 337 1.0E-08
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 252 333 1.0E-08
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 250 333 1.0E-08
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 245 331 1.0E-08
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 250 337 1.0E-08
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 252 337 1.0E-08
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 212 331 1.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 257 337 1.0E-08
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 246 337 1.0E-08
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 236 354 1.0E-08
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 331 1.0E-08
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 245 337 1.0E-08
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 252 333 1.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 252 337 1.0E-08
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 252 337 1.0E-08
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 236 337 1.0E-08
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 246 337 1.0E-08
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 246 337 1.0E-08
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 252 337 1.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 245 354 1.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 236 337 1.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 252 337 1.0E-08
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 245 333 1.0E-08
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 252 337 1.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 213 337 1.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 250 331 1.0E-08
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 245 333 1.0E-08
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 246 337 1.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 252 337 1.0E-08
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 236 337 1.0E-08
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 245 331 1.0E-08
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 245 333 1.0E-08
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 236 337 1.0E-08
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 257 337 1.0E-08
sp|Q9VQS7|SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster GN=sob PE=2 SV=1 257 307 1.0E-08
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 236 337 1.0E-08
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 213 333 1.0E-08
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 250 333 1.0E-08
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 252 337 1.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 245 337 1.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 245 337 1.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 100 337 1.0E-08
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 245 333 1.0E-08
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 246 337 1.0E-08
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 245 331 1.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 252 337 1.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 245 337 1.0E-08
sp|Q64321|ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus GN=Zbtb7b PE=1 SV=2 259 331 2.0E-08
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 254 333 2.0E-08
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 252 337 2.0E-08
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 252 337 2.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 259 337 2.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 248 333 2.0E-08
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 331 2.0E-08
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 245 330 2.0E-08
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 245 337 2.0E-08
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 245 337 2.0E-08
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 250 335 2.0E-08
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 252 333 2.0E-08
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 245 333 2.0E-08
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 231 337 2.0E-08
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 255 333 2.0E-08
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 185 337 2.0E-08
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 245 331 2.0E-08
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 250 335 2.0E-08
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 252 333 2.0E-08
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 250 335 2.0E-08
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 250 335 2.0E-08
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 252 333 2.0E-08
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 193 337 2.0E-08
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 238 333 2.0E-08
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 236 333 2.0E-08
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 216 337 2.0E-08
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 250 335 2.0E-08
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 252 333 2.0E-08
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 252 337 2.0E-08
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 245 337 2.0E-08
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 252 337 2.0E-08
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 266 333 2.0E-08
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 252 331 2.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 252 333 2.0E-08
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 245 337 2.0E-08
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 331 2.0E-08
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 337 2.0E-08
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 255 337 2.0E-08
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 252 337 2.0E-08
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 250 333 2.0E-08
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 255 337 2.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 250 333 2.0E-08
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 259 337 2.0E-08
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 250 333 2.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 242 337 2.0E-08
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 272 333 2.0E-08
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 2.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 245 337 2.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 252 337 2.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 245 337 2.0E-08
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 246 333 2.0E-08
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 252 331 2.0E-08
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 253 333 2.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 246 337 2.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 246 333 2.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 252 337 2.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 252 337 2.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 258 337 2.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 246 337 2.0E-08
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 236 337 2.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 252 337 2.0E-08
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 252 337 2.0E-08
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 236 337 2.0E-08
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 236 333 2.0E-08
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 246 337 2.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 252 337 2.0E-08
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 236 337 2.0E-08
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 236 337 2.0E-08
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 236 337 2.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 252 337 2.0E-08
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 255 337 2.0E-08
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 246 337 2.0E-08
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 245 337 2.0E-08
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 250 337 2.0E-08
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 253 331 2.0E-08
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 253 331 2.0E-08
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 253 331 2.0E-08
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 250 337 2.0E-08
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 236 337 2.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 258 337 2.0E-08
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 252 337 2.0E-08
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 236 337 2.0E-08
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 252 337 2.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 246 337 2.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 246 334 2.0E-08
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 252 333 3.0E-08
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 259 337 3.0E-08
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 252 337 3.0E-08
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 259 333 3.0E-08
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 250 331 3.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 245 337 3.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 245 354 3.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 252 336 3.0E-08
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 237 331 3.0E-08
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 255 337 3.0E-08
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 250 358 3.0E-08
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 250 334 3.0E-08
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 245 337 3.0E-08
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 232 337 3.0E-08
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 250 335 3.0E-08
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 236 337 3.0E-08
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 252 331 3.0E-08
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 253 337 3.0E-08
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 252 337 3.0E-08
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 166 337 3.0E-08
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 240 331 3.0E-08
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 245 337 3.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 252 337 3.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 252 333 3.0E-08
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 245 337 3.0E-08
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 245 333 3.0E-08
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 257 337 3.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 252 337 3.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 252 337 3.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 252 337 3.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 245 337 3.0E-08
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 252 337 3.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 252 337 3.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 252 337 3.0E-08
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 250 333 3.0E-08
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 259 331 3.0E-08
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 252 333 3.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 246 333 3.0E-08
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 252 337 3.0E-08
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 236 337 3.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 252 333 3.0E-08
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 246 337 3.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 331 3.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 337 3.0E-08
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 236 337 3.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 245 333 3.0E-08
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 252 337 3.0E-08
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 236 337 3.0E-08
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 252 337 3.0E-08
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 238 337 3.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 252 333 3.0E-08
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 252 337 3.0E-08
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 252 337 3.0E-08
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 229 333 3.0E-08
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 257 337 3.0E-08
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 252 331 4.0E-08
sp|Q96CS4|ZN689_HUMAN Zinc finger protein 689 OS=Homo sapiens GN=ZNF689 PE=2 SV=1 250 337 4.0E-08
sp|Q99PJ7|ZN689_RAT Zinc finger protein 689 OS=Rattus norvegicus GN=Znf689 PE=2 SV=1 250 337 4.0E-08
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 252 337 4.0E-08
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 245 331 4.0E-08
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 250 333 4.0E-08
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 245 337 4.0E-08
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 245 337 4.0E-08
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 245 341 4.0E-08
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 259 334 4.0E-08
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 245 337 4.0E-08
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 266 333 4.0E-08
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 236 337 4.0E-08
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 252 337 4.0E-08
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 236 337 4.0E-08
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 252 331 4.0E-08
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 252 331 4.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 252 337 4.0E-08
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 236 337 4.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 236 337 4.0E-08
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 245 337 4.0E-08
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 242 337 4.0E-08
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 258 331 4.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 252 337 4.0E-08
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 252 331 4.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 246 337 4.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 245 337 4.0E-08
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 253 337 4.0E-08
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 245 337 4.0E-08
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 252 337 4.0E-08
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 245 337 4.0E-08
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 252 337 4.0E-08
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 252 331 5.0E-08
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 252 323 5.0E-08
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 252 337 5.0E-08
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 236 331 5.0E-08
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 252 311 5.0E-08
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 250 335 5.0E-08
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 252 311 5.0E-08
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 252 337 5.0E-08
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 252 337 5.0E-08
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 236 337 5.0E-08
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 252 331 5.0E-08
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 252 331 5.0E-08
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 252 361 5.0E-08
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 259 334 5.0E-08
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 213 337 5.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 257 337 5.0E-08
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 255 337 5.0E-08
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 246 333 5.0E-08
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 259 331 5.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 245 337 5.0E-08
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 244 331 5.0E-08
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 252 333 5.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 236 337 5.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 258 337 5.0E-08
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 252 337 5.0E-08
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 236 337 5.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 245 337 5.0E-08
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 246 337 5.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 337 5.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 331 5.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 245 337 5.0E-08
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 224 322 5.0E-08
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 246 331 5.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 245 337 5.0E-08
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 250 337 5.0E-08
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 245 333 5.0E-08
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 239 331 5.0E-08
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 252 337 5.0E-08
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 245 337 5.0E-08
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 252 337 6.0E-08
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 252 337 6.0E-08
sp|Q96CS4|ZN689_HUMAN Zinc finger protein 689 OS=Homo sapiens GN=ZNF689 PE=2 SV=1 250 352 6.0E-08
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 252 331 6.0E-08
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 252 331 6.0E-08
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 250 337 6.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 259 337 6.0E-08
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 255 337 6.0E-08
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 252 337 6.0E-08
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 252 311 6.0E-08
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 245 333 6.0E-08
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 245 337 6.0E-08
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 245 337 6.0E-08
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 245 337 6.0E-08
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 245 333 6.0E-08
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 250 337 6.0E-08
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 229 337 6.0E-08
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 236 337 6.0E-08
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 6.0E-08
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 245 337 6.0E-08
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 252 331 6.0E-08
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 246 337 6.0E-08
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 239 331 6.0E-08
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 194 331 7.0E-08
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 245 331 7.0E-08
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 242 336 7.0E-08
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 242 336 7.0E-08
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 252 311 7.0E-08
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 258 337 7.0E-08
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 252 333 7.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 252 337 7.0E-08
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 337 7.0E-08
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 252 337 7.0E-08
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 245 331 7.0E-08
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 250 333 7.0E-08
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 233 345 7.0E-08
sp|A8K8V0|ZN785_HUMAN Zinc finger protein 785 OS=Homo sapiens GN=ZNF785 PE=1 SV=1 224 349 7.0E-08
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 331 7.0E-08
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 252 337 7.0E-08
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 258 337 7.0E-08
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 236 337 7.0E-08
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 236 337 7.0E-08
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 239 373 7.0E-08
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 252 337 7.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 250 333 7.0E-08
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 259 331 8.0E-08
sp|Q9JKY3|ZBT18_RAT Zinc finger and BTB domain-containing protein 18 OS=Rattus norvegicus GN=Zbtb18 PE=1 SV=1 253 332 8.0E-08
sp|Q99592|ZBT18_HUMAN Zinc finger and BTB domain-containing protein 18 OS=Homo sapiens GN=ZBTB18 PE=1 SV=1 253 332 8.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 252 337 8.0E-08
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 252 311 8.0E-08
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 250 331 8.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 252 333 8.0E-08
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 208 337 8.0E-08
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 8.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 246 337 8.0E-08
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 245 331 8.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 245 337 8.0E-08
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 252 331 8.0E-08
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 236 337 8.0E-08
sp|Q9WUK6|ZBT18_MOUSE Zinc finger and BTB domain-containing protein 18 OS=Mus musculus GN=Zbtb18 PE=1 SV=1 253 332 9.0E-08
sp|Q5ZM39|BCL6_CHICK B-cell lymphoma 6 protein homolog OS=Gallus gallus GN=BCL6 PE=2 SV=1 259 337 9.0E-08
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 252 331 9.0E-08
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 252 311 9.0E-08
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 252 333 9.0E-08
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 245 333 9.0E-08
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 245 337 9.0E-08
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 252 311 9.0E-08
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 252 333 9.0E-08
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 337 9.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 252 337 9.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 252 337 9.0E-08
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 257 337 9.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 255 337 9.0E-08
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 236 337 9.0E-08
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 245 337 9.0E-08
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 161 337 9.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 246 337 9.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 250 333 9.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 157 337 1.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 253 337 1.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 236 333 1.0E-07
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 337 1.0E-07
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 256 331 1.0E-07
sp|Q96CS4|ZN689_HUMAN Zinc finger protein 689 OS=Homo sapiens GN=ZNF689 PE=2 SV=1 245 331 1.0E-07
sp|Q8BKK5|ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus GN=Znf689 PE=2 SV=1 252 337 1.0E-07
sp|Q99PJ7|ZN689_RAT Zinc finger protein 689 OS=Rattus norvegicus GN=Znf689 PE=2 SV=1 245 331 1.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 253 337 1.0E-07
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 233 331 1.0E-07
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 252 337 1.0E-07
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 252 311 1.0E-07
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 236 331 1.0E-07
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 252 332 1.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 245 331 1.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 253 337 1.0E-07
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 252 333 1.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 238 337 1.0E-07
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 243 337 1.0E-07
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 252 337 1.0E-07
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 337 1.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 236 337 1.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 252 337 1.0E-07
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 248 337 1.0E-07
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 245 333 1.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 252 333 1.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 252 333 1.0E-07
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 235 337 1.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 331 1.0E-07
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 253 333 1.0E-07
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 252 333 1.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 245 331 1.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 245 337 1.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 252 331 1.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 252 337 1.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 236 333 1.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 245 337 1.0E-07
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 244 331 1.0E-07
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 250 337 1.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 246 333 1.0E-07
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 252 337 1.0E-07
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 246 337 1.0E-07
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 246 333 1.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 252 337 1.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 245 331 1.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 257 337 1.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 245 331 1.0E-07
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 232 333 1.0E-07
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 252 337 1.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 337 1.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 337 1.0E-07
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 236 337 1.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 250 333 1.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 245 337 1.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 252 337 1.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 252 331 1.0E-07
sp|Q9ULM2|ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens GN=ZNF490 PE=1 SV=2 252 337 1.0E-07
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 236 337 1.0E-07
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 251 337 1.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 252 337 1.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 252 337 1.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 252 337 1.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 228 337 1.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 245 337 1.0E-07
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 236 337 1.0E-07
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 236 333 1.0E-07
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 252 337 1.0E-07
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 236 337 1.0E-07
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 245 337 1.0E-07
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 333 1.0E-07
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 238 345 1.0E-07
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 250 337 1.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 236 331 1.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 253 337 1.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 250 333 1.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 252 337 1.0E-07
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 252 331 1.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 236 337 1.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 253 337 2.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 236 333 2.0E-07
sp|A0JN76|ZBT18_BOVIN Zinc finger and BTB domain-containing protein 18 OS=Bos taurus GN=ZBTB18 PE=2 SV=2 253 332 2.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 252 337 2.0E-07
sp|Q1L8W0|ZBT18_DANRE Zinc finger and BTB domain-containing protein 18 OS=Danio rerio GN=zbtb18 PE=2 SV=1 259 332 2.0E-07
sp|Q801P1|ZBT18_XENLA Zinc finger and BTB domain-containing protein 18 OS=Xenopus laevis GN=zbtb18 PE=2 SV=2 248 332 2.0E-07
sp|Q96CS4|ZN689_HUMAN Zinc finger protein 689 OS=Homo sapiens GN=ZNF689 PE=2 SV=1 235 331 2.0E-07
sp|Q8BKK5|ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus GN=Znf689 PE=2 SV=1 250 331 2.0E-07
sp|Q8BKK5|ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus GN=Znf689 PE=2 SV=1 235 331 2.0E-07
sp|Q8BKK5|ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus GN=Znf689 PE=2 SV=1 245 331 2.0E-07
sp|Q99PJ7|ZN689_RAT Zinc finger protein 689 OS=Rattus norvegicus GN=Znf689 PE=2 SV=1 250 331 2.0E-07
sp|Q99PJ7|ZN689_RAT Zinc finger protein 689 OS=Rattus norvegicus GN=Znf689 PE=2 SV=1 235 331 2.0E-07
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 242 331 2.0E-07
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 272 333 2.0E-07
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 252 311 2.0E-07
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 245 333 2.0E-07
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 250 337 2.0E-07
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 252 311 2.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 250 333 2.0E-07
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 252 337 2.0E-07
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 252 311 2.0E-07
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 252 311 2.0E-07
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 252 311 2.0E-07
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 252 311 2.0E-07
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 245 337 2.0E-07
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 252 337 2.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 245 331 2.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 245 337 2.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 252 333 2.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 252 333 2.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 236 337 2.0E-07
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 252 333 2.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 252 332 2.0E-07
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 236 331 2.0E-07
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 252 311 2.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 250 337 2.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 252 337 2.0E-07
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 255 331 2.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 236 337 2.0E-07
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 252 331 2.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 337 2.0E-07
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 236 331 2.0E-07
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 245 337 2.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 252 333 2.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 245 331 2.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 252 337 2.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 245 331 2.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 250 337 2.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 252 337 2.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 245 337 2.0E-07
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 253 337 2.0E-07
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 244 331 2.0E-07
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 271 331 2.0E-07
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 252 333 2.0E-07
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 246 333 2.0E-07
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 250 331 2.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 252 331 2.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 246 337 2.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 181 337 2.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 252 331 2.0E-07
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 236 337 2.0E-07
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 258 337 2.0E-07
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 252 337 2.0E-07
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 252 331 2.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 246 337 2.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 265 337 2.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 245 333 2.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 245 331 2.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 255 337 2.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 245 337 2.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 245 331 2.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 255 337 2.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 193 337 2.0E-07
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 250 333 2.0E-07
sp|Q9WTJ4|FIZ1_MOUSE Flt3-interacting zinc finger protein 1 OS=Mus musculus GN=Fiz1 PE=1 SV=1 259 333 2.0E-07
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 250 331 2.0E-07
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 250 337 2.0E-07
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 227 333 2.0E-07
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 260 337 2.0E-07
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 250 333 2.0E-07
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 245 337 2.0E-07
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 252 349 2.0E-07
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 245 333 2.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 250 333 2.0E-07
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 232 333 2.0E-07
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 236 337 2.0E-07
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 252 337 2.0E-07
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 252 337 2.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 245 337 3.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 252 333 3.0E-07
sp|Q0IJ29|ZBT18_XENTR Zinc finger and BTB domain-containing protein 18 OS=Xenopus tropicalis GN=zbtb18 PE=2 SV=1 253 332 3.0E-07
sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens GN=PRDM5 PE=1 SV=2 259 333 3.0E-07
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 237 333 3.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 259 337 3.0E-07
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 260 337 3.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 252 333 3.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 245 337 3.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 250 337 3.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 252 333 3.0E-07
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 252 331 3.0E-07
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 259 331 3.0E-07
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 252 311 3.0E-07
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 252 311 3.0E-07
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 252 311 3.0E-07
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 259 337 3.0E-07
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 252 331 3.0E-07
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 253 333 3.0E-07
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 250 337 3.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 252 333 3.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 252 333 3.0E-07
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 252 316 3.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 161 337 3.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 245 337 3.0E-07
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 252 337 3.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 252 332 3.0E-07
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 250 354 3.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 252 332 3.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 213 333 3.0E-07
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 238 337 3.0E-07
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 238 337 3.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 252 337 3.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 252 337 3.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 331 3.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 236 337 3.0E-07
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 252 337 3.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 245 337 3.0E-07
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 252 337 3.0E-07
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 245 337 3.0E-07
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 224 337 3.0E-07
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 270 333 3.0E-07
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 245 337 3.0E-07
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 245 337 3.0E-07
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 252 331 3.0E-07
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 252 337 3.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 236 337 3.0E-07
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 240 331 4.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 250 331 4.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 236 331 4.0E-07
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 259 333 4.0E-07
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 259 333 4.0E-07
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 252 337 4.0E-07
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 258 337 4.0E-07
sp|Q66K89|E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens GN=E4F1 PE=1 SV=2 255 333 4.0E-07
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 252 337 4.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 253 354 4.0E-07
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 252 333 4.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 252 333 4.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 331 4.0E-07
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 282 333 4.0E-07
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 245 331 4.0E-07
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 259 337 4.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 250 333 4.0E-07
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 252 311 4.0E-07
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 250 333 4.0E-07
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 245 312 4.0E-07
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 252 333 4.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 255 331 4.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 245 337 4.0E-07
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 246 337 4.0E-07
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 252 324 4.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 252 337 4.0E-07
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 229 333 4.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 245 337 4.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 245 337 4.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 245 331 4.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 245 337 4.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 213 337 4.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 245 337 4.0E-07
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 245 331 4.0E-07
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 252 331 4.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 255 331 4.0E-07
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 236 337 4.0E-07
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 250 337 4.0E-07
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 259 331 4.0E-07
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 245 333 4.0E-07
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 250 337 4.0E-07
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 242 337 4.0E-07
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 252 337 4.0E-07
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 245 337 5.0E-07
sp|Q6NRM8|ZB183_XENLA Zinc finger and BTB domain-containing protein 18.3 OS=Xenopus laevis GN=zbtb18.3 PE=2 SV=1 253 332 5.0E-07
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 252 337 5.0E-07
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 252 337 5.0E-07
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 243 337 5.0E-07
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 259 337 5.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 252 337 5.0E-07
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 252 331 5.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 245 337 5.0E-07
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 252 311 5.0E-07
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 236 337 5.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 252 331 5.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 250 333 5.0E-07
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 250 337 5.0E-07
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 252 337 5.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 213 337 5.0E-07
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 245 337 5.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 246 337 5.0E-07
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 259 333 5.0E-07
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 252 337 5.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 245 331 5.0E-07
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 245 337 5.0E-07
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 255 337 5.0E-07
sp|Q8N2I2|ZN619_HUMAN Zinc finger protein 619 OS=Homo sapiens GN=ZNF619 PE=2 SV=1 245 333 5.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 245 331 5.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 213 333 5.0E-07
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 257 331 5.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 252 337 5.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 245 331 5.0E-07
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 244 331 5.0E-07
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 257 337 5.0E-07
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 245 337 5.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 236 337 5.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 226 337 5.0E-07
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 255 333 6.0E-07
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 237 337 6.0E-07
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 252 337 6.0E-07
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 259 331 6.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 246 337 6.0E-07
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 252 333 6.0E-07
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 252 311 6.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 252 331 6.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 235 333 6.0E-07
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 252 333 6.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 236 337 6.0E-07
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 252 331 6.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 245 337 6.0E-07
sp|Q8N2I2|ZN619_HUMAN Zinc finger protein 619 OS=Homo sapiens GN=ZNF619 PE=2 SV=1 224 337 6.0E-07
sp|Q9ULM2|ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens GN=ZNF490 PE=1 SV=2 252 337 6.0E-07
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 252 331 6.0E-07
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 244 331 6.0E-07
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 252 337 6.0E-07
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 246 331 6.0E-07
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 245 334 6.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 245 337 6.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 245 337 6.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 259 337 6.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 236 337 6.0E-07
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 210 337 7.0E-07
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 193 337 7.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 259 333 7.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 259 333 7.0E-07
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 245 337 7.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 252 337 7.0E-07
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 252 337 7.0E-07
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 252 333 7.0E-07
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 259 337 7.0E-07
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 257 337 7.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 253 337 7.0E-07
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 252 333 7.0E-07
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 252 337 7.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 255 337 7.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 245 337 7.0E-07
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 250 333 7.0E-07
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 255 337 7.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 229 337 8.0E-07
sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens GN=PRDM5 PE=1 SV=2 257 331 8.0E-07
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 246 337 8.0E-07
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 236 331 8.0E-07
sp|Q5DWN0|GFI1_CANLF Zinc finger protein Gfi-1 OS=Canis lupus familiaris GN=GFI1 PE=2 SV=1 259 331 8.0E-07
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 236 331 8.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 252 333 8.0E-07
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 245 337 8.0E-07
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 251 337 8.0E-07
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 242 333 8.0E-07
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 252 333 8.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 252 331 8.0E-07
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 252 335 8.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 236 337 8.0E-07
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 252 337 8.0E-07
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 250 337 8.0E-07
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 250 337 8.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 245 337 8.0E-07
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 236 331 8.0E-07
sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens GN=PRDM5 PE=1 SV=2 255 331 9.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 237 333 9.0E-07
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 232 337 9.0E-07
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 259 331 9.0E-07
sp|P70338|GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus GN=Gfi1 PE=1 SV=2 259 331 9.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 259 337 9.0E-07
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 252 337 9.0E-07
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 255 337 9.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 337 9.0E-07
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 252 337 9.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 245 337 9.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 245 337 9.0E-07
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 259 337 9.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 252 331 9.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 246 333 9.0E-07
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 252 337 9.0E-07
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 252 337 9.0E-07
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 252 337 9.0E-07
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 244 331 9.0E-07
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 252 337 9.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 236 337 9.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 245 331 1.0E-06
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 252 307 1.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 236 337 1.0E-06
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 250 322 1.0E-06
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 165 337 1.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 255 333 1.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 236 337 1.0E-06
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 249 333 1.0E-06
sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 255 337 1.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 216 331 1.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 252 331 1.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 250 337 1.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 250 337 1.0E-06
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 252 331 1.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 252 331 1.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 255 337 1.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 255 337 1.0E-06
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 236 337 1.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 252 331 1.0E-06
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 253 333 1.0E-06
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 257 337 1.0E-06
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 250 337 1.0E-06
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 253 333 1.0E-06
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 257 337 1.0E-06
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 253 333 1.0E-06
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 257 337 1.0E-06
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 253 333 1.0E-06
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 257 337 1.0E-06
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 253 333 1.0E-06
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 257 337 1.0E-06
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 249 322 1.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 252 333 1.0E-06
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 252 333 1.0E-06
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 259 333 1.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 245 331 1.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 246 337 1.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 252 331 1.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 256 331 1.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 245 337 1.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 252 333 1.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 245 331 1.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 245 337 1.0E-06
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 253 337 1.0E-06
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 276 333 1.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 245 337 1.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 252 337 1.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 337 1.0E-06
sp|Q8N2I2|ZN619_HUMAN Zinc finger protein 619 OS=Homo sapiens GN=ZNF619 PE=2 SV=1 252 337 1.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 252 337 1.0E-06
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 252 337 1.0E-06
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 249 331 1.0E-06
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 252 337 1.0E-06
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 259 331 1.0E-06
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 259 331 1.0E-06
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 250 337 1.0E-06
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 246 331 1.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 245 337 1.0E-06
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 245 337 1.0E-06
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 250 349 1.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 245 337 1.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 252 349 1.0E-06
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 253 343 2.0E-06
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 253 343 2.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 245 311 2.0E-06
sp|Q8TF68|ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens GN=ZNF384 PE=1 SV=2 252 331 2.0E-06
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 250 322 2.0E-06
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 252 333 2.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 250 337 2.0E-06
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 245 311 2.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 252 333 2.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 252 333 2.0E-06
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 252 333 2.0E-06
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 257 337 2.0E-06
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 257 337 2.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 236 337 2.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 257 337 2.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 250 337 2.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 252 337 2.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 272 333 2.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 262 337 2.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 252 331 2.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 245 337 2.0E-06
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 252 311 2.0E-06
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 250 337 2.0E-06
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 250 337 2.0E-06
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 250 337 2.0E-06
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 254 331 2.0E-06
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 250 337 2.0E-06
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 250 337 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 245 331 2.0E-06
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 241 337 2.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 252 331 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 245 331 2.0E-06
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 266 331 2.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 236 337 2.0E-06
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 253 337 2.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 252 331 2.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 245 337 2.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 255 337 2.0E-06
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 257 333 2.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 331 2.0E-06
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 252 331 2.0E-06
sp|Q9ULM2|ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens GN=ZNF490 PE=1 SV=2 236 337 2.0E-06
sp|Q9ULM2|ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens GN=ZNF490 PE=1 SV=2 250 337 2.0E-06
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 236 337 2.0E-06
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 245 333 2.0E-06
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 200 337 2.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 252 337 2.0E-06
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 245 333 2.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 250 337 2.0E-06
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 232 337 2.0E-06
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 252 337 2.0E-06
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 266 331 2.0E-06
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 236 337 2.0E-06
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 252 337 2.0E-06
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 252 331 2.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 245 337 2.0E-06
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 191 331 3.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 252 337 3.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 243 337 3.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 252 333 3.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 250 333 3.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 236 337 3.0E-06
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 253 335 3.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 246 331 3.0E-06
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 252 331 3.0E-06
sp|Q9EQJ4|ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus GN=Znf384 PE=1 SV=1 252 331 3.0E-06
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 280 331 3.0E-06
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 259 334 3.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 273 337 3.0E-06
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 250 361 3.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 245 337 3.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 216 337 3.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 252 337 3.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 252 337 3.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 252 331 3.0E-06
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 252 333 3.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 250 337 3.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 246 337 3.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 236 337 3.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 256 331 3.0E-06
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 252 337 3.0E-06
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 259 331 3.0E-06
sp|Q8N895|ZN366_HUMAN Zinc finger protein 366 OS=Homo sapiens GN=ZNF366 PE=1 SV=1 252 337 3.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 200 337 3.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 233 337 3.0E-06
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 236 337 3.0E-06
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 245 331 3.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 237 331 3.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 252 331 3.0E-06
sp|Q8N2I2|ZN619_HUMAN Zinc finger protein 619 OS=Homo sapiens GN=ZNF619 PE=2 SV=1 252 337 3.0E-06
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 252 337 3.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 236 331 3.0E-06
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 250 337 3.0E-06
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 257 337 3.0E-06
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 252 331 3.0E-06
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 266 331 3.0E-06
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 3.0E-06
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 258 333 3.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 245 333 4.0E-06
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 282 333 4.0E-06
sp|P18719|ZG32_XENLA Gastrula zinc finger protein XlCGF32.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 281 331 4.0E-06
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 252 331 4.0E-06
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 259 331 4.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 245 337 4.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 250 337 4.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 252 333 4.0E-06
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 333 4.0E-06
sp|P57071|PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens GN=PRDM15 PE=2 SV=4 259 333 4.0E-06
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 252 331 4.0E-06
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 259 331 4.0E-06
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 259 331 4.0E-06
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 236 331 4.0E-06
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 252 337 4.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 257 337 4.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 252 337 4.0E-06
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 252 331 4.0E-06
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 236 337 4.0E-06
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 252 337 4.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 255 337 4.0E-06
sp|B1WBS3|ZBT42_RAT Zinc finger and BTB domain-containing protein 42 OS=Rattus norvegicus GN=Zbtb42 PE=2 SV=1 259 332 5.0E-06
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 252 331 5.0E-06
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 259 331 5.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 252 313 5.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 250 331 5.0E-06
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 259 331 5.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 277 337 5.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 252 333 5.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 252 331 5.0E-06
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 259 337 5.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 252 333 5.0E-06
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 250 337 5.0E-06
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 232 337 5.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 252 337 5.0E-06
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 241 337 5.0E-06
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 146 333 5.0E-06
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 252 312 5.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 252 337 5.0E-06
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 252 337 5.0E-06
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 252 337 5.0E-06
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 259 337 6.0E-06
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 249 331 6.0E-06
sp|Q96CS4|ZN689_HUMAN Zinc finger protein 689 OS=Homo sapiens GN=ZNF689 PE=2 SV=1 259 331 6.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 252 337 6.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 245 337 6.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 252 331 6.0E-06
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 253 337 6.0E-06
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 239 331 6.0E-06
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 232 333 6.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 250 315 6.0E-06
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 252 337 6.0E-06
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 257 331 6.0E-06
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 238 337 6.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 259 331 6.0E-06
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 245 333 6.0E-06
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 250 337 6.0E-06
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 245 337 6.0E-06
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 272 331 6.0E-06
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 249 331 7.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 252 331 7.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 242 331 7.0E-06
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 250 337 7.0E-06
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 250 337 7.0E-06
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 250 337 7.0E-06
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 250 337 7.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 252 337 7.0E-06
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 252 337 7.0E-06
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 252 337 7.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 245 337 7.0E-06
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 246 331 7.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 246 337 7.0E-06
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 250 312 7.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 253 331 7.0E-06
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 252 333 7.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 235 333 7.0E-06
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 250 331 7.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 245 333 7.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 250 337 7.0E-06
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 245 337 7.0E-06
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 245 337 7.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 236 337 7.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 252 331 7.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 234 331 8.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 252 337 8.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 252 331 8.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 252 337 8.0E-06
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 259 337 8.0E-06
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 252 316 8.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 236 337 8.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 245 337 8.0E-06
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 252 307 9.0E-06
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 236 312 9.0E-06
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 282 333 9.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 236 337 1.0E-05
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 236 312 1.0E-05
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 250 337 1.0E-05
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 250 307 1.0E-05
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 245 337 1.0E-05
sp|Q8N2I2|ZN619_HUMAN Zinc finger protein 619 OS=Homo sapiens GN=ZNF619 PE=2 SV=1 245 337 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8354
MASGAGALAAEAPPLARPSANTPPGSLASPDGIARLPKRQRESESASPRAQAAQAAQAFNPLGSPTKSARLALAT
TGSKSPPPLTGAAALQDERWRRRDESAPASPAPTSPNPSHRILESLMSAATQAMSRPADAPQVAPTANMDPTAKA
VSALSIPPSGPARADDRAESSPQSASSMVGVPVTESPTPMDVDGGKADQLSAQQVAGHDERPQPGSLSYPGSLQT
PGAVTDQSMRGMSFPAPGQIQGSPTSTGGKKHRCPYCQTEFTRHHNLKSHLLTHSQEKPYVCTECQMRFRRLHDL
KRHGKLHTGEKPHVCPKCDRKFARGDALARHSKGAGGCAGRRASMGSFVEGDELDGAMGEGEETAMSGITYENGD
DEELRRQSLPSLGSQHAPGAQGDAYNAHSRTYPPAGPRPAAGGLYPPNVNPGQAAAGNSGTSSLPSSLASSNTAN
TSTSSGPPGGGNTGLFSQSGMTESPKPLSPGAQAHEPSSNVARQRSPSLTQQFQQHMARRPSELQSPHGGQPRPK
LPGLSHPGFTAPGAAAYSHGRTPSGTQPSGDSGNMFAQSDPNVWAYIQTLEDKVKFLADKVTLLEHEVLGRKKQH
ENRESRDGAAAST*
Coding >Hirsu2|8354
ATGGCATCAGGCGCCGGCGCTCTTGCAGCAGAAGCGCCGCCCTTAGCTCGCCCGAGCGCCAACACCCCGCCCGGC
TCCCTCGCCTCTCCGGACGGCATCGCGAGGCTGCCCAAGCGACAGCGCGAGTCGGAGTCGGCGTCGCCGCGCGCC
CAGGCCGCCCAGGCCGCCCAGGCCTTCAATCCCCTGGGGTCGCCGACCAAGTCGGCCCGCCTGGCCCTTGCGACG
ACGGGCAGCAAGTCGCCCCCGCCCCTCACCGGCGCCGCCGCGCTCCAGGACGAGCGCTGGCGCAGGCGAGACGAG
TCTGCGCCCGCCTCCCCGGCCCCAACCAGTCCGAATCCCAGCCATCGGATCCTGGAATCCCTCATGTCCGCCGCC
ACCCAGGCTATGAGCCGTCCCGCCGACGCACCCCAGGTCGCGCCCACGGCCAACATGGACCCCACCGCCAAAGCC
GTCTCCGCCTTGTCGATACCCCCGAGCGGCCCTGCCCGCGCCGACGACCGCGCCGAGTCGAGTCCACAGAGCGCC
TCGAGCATGGTCGGCGTGCCGGTGACGGAGAGCCCGACGCCCATGGACGTCGACGGGGGCAAGGCTGACCAGCTG
TCCGCCCAGCAGGTCGCCGGCCACGACGAGCGGCCGCAACCGGGCTCCCTGTCGTACCCCGGATCTCTTCAGACG
CCCGGCGCCGTGACCGACCAGTCCATGCGCGGCATGAGCTTCCCCGCGCCCGGTCAGATTCAGGGCTCGCCGACT
TCGACGGGCGGCAAGAAGCACCGATGCCCCTACTGCCAGACCGAGTTCACGCGGCACCACAATCTCAAGAGCCAC
CTCCTGACGCACAGCCAGGAGAAGCCGTACGTCTGCACCGAGTGCCAGATGCGCTTCCGCCGCCTGCACGACCTC
AAGAGACACGGCAAGCTGCACACGGGCGAGAAGCCCCATGTGTGCCCCAAGTGCGACCGCAAGTTTGCCCGAGGG
GACGCCCTGGCCCGGCACAGCAAGGGCGCCGGCGGATGCGCGGGGCGAAGGGCCAGCATGGGCAGCTTTGTTGAG
GGGGACGAGCTGGACGGGGCCATGGGCGAAGGGGAAGAGACGGCCATGTCGGGCATCACCTACGAGAACGGCGAC
GACGAAGAGCTCAGACGCCAGAGCCTGCCCAGCCTGGGCTCGCAACACGCCCCCGGCGCGCAAGGCGACGCCTAT
AATGCCCACTCGCGCACGTATCCGCCGGCCGGGCCGCGACCCGCCGCGGGCGGCCTGTATCCTCCGAATGTCAAC
CCGGGCCAGGCGGCCGCCGGCAACAGCGGCACGTCGAGCCTGCCGAGCAGCTTGGCCAGCAGCAACACGGCCAAC
ACGAGCACGTCGTCTGGCCCCCCCGGCGGCGGCAACACCGGCCTGTTTTCGCAATCCGGCATGACGGAGAGCCCG
AAGCCGTTGAGCCCCGGCGCCCAGGCGCACGAGCCGTCCTCCAACGTGGCGCGGCAGCGATCGCCAAGCCTGACG
CAGCAGTTCCAGCAGCACATGGCTCGGAGGCCGTCCGAGCTGCAGTCGCCACACGGCGGGCAGCCCCGGCCCAAG
CTACCGGGACTCTCGCATCCCGGGTTTACCGCTCCCGGCGCGGCGGCATACAGCCACGGGCGCACGCCGAGCGGG
ACGCAGCCCAGCGGCGACAGCGGCAACATGTTTGCGCAGAGCGACCCGAACGTCTGGGCCTATATCCAGACGTTG
GAGGACAAGGTCAAATTCTTGGCCGACAAAGTCACCCTGCTGGAACACGAGGTTCTGGGGCGGAAGAAGCAGCAC
GAGAACCGAGAGAGCCGCGATGGCGCGGCGGCGAGCACGTGA
Transcript >Hirsu2|8354
ATGGCATCAGGCGCCGGCGCTCTTGCAGCAGAAGCGCCGCCCTTAGCTCGCCCGAGCGCCAACACCCCGCCCGGC
TCCCTCGCCTCTCCGGACGGCATCGCGAGGCTGCCCAAGCGACAGCGCGAGTCGGAGTCGGCGTCGCCGCGCGCC
CAGGCCGCCCAGGCCGCCCAGGCCTTCAATCCCCTGGGGTCGCCGACCAAGTCGGCCCGCCTGGCCCTTGCGACG
ACGGGCAGCAAGTCGCCCCCGCCCCTCACCGGCGCCGCCGCGCTCCAGGACGAGCGCTGGCGCAGGCGAGACGAG
TCTGCGCCCGCCTCCCCGGCCCCAACCAGTCCGAATCCCAGCCATCGGATCCTGGAATCCCTCATGTCCGCCGCC
ACCCAGGCTATGAGCCGTCCCGCCGACGCACCCCAGGTCGCGCCCACGGCCAACATGGACCCCACCGCCAAAGCC
GTCTCCGCCTTGTCGATACCCCCGAGCGGCCCTGCCCGCGCCGACGACCGCGCCGAGTCGAGTCCACAGAGCGCC
TCGAGCATGGTCGGCGTGCCGGTGACGGAGAGCCCGACGCCCATGGACGTCGACGGGGGCAAGGCTGACCAGCTG
TCCGCCCAGCAGGTCGCCGGCCACGACGAGCGGCCGCAACCGGGCTCCCTGTCGTACCCCGGATCTCTTCAGACG
CCCGGCGCCGTGACCGACCAGTCCATGCGCGGCATGAGCTTCCCCGCGCCCGGTCAGATTCAGGGCTCGCCGACT
TCGACGGGCGGCAAGAAGCACCGATGCCCCTACTGCCAGACCGAGTTCACGCGGCACCACAATCTCAAGAGCCAC
CTCCTGACGCACAGCCAGGAGAAGCCGTACGTCTGCACCGAGTGCCAGATGCGCTTCCGCCGCCTGCACGACCTC
AAGAGACACGGCAAGCTGCACACGGGCGAGAAGCCCCATGTGTGCCCCAAGTGCGACCGCAAGTTTGCCCGAGGG
GACGCCCTGGCCCGGCACAGCAAGGGCGCCGGCGGATGCGCGGGGCGAAGGGCCAGCATGGGCAGCTTTGTTGAG
GGGGACGAGCTGGACGGGGCCATGGGCGAAGGGGAAGAGACGGCCATGTCGGGCATCACCTACGAGAACGGCGAC
GACGAAGAGCTCAGACGCCAGAGCCTGCCCAGCCTGGGCTCGCAACACGCCCCCGGCGCGCAAGGCGACGCCTAT
AATGCCCACTCGCGCACGTATCCGCCGGCCGGGCCGCGACCCGCCGCGGGCGGCCTGTATCCTCCGAATGTCAAC
CCGGGCCAGGCGGCCGCCGGCAACAGCGGCACGTCGAGCCTGCCGAGCAGCTTGGCCAGCAGCAACACGGCCAAC
ACGAGCACGTCGTCTGGCCCCCCCGGCGGCGGCAACACCGGCCTGTTTTCGCAATCCGGCATGACGGAGAGCCCG
AAGCCGTTGAGCCCCGGCGCCCAGGCGCACGAGCCGTCCTCCAACGTGGCGCGGCAGCGATCGCCAAGCCTGACG
CAGCAGTTCCAGCAGCACATGGCTCGGAGGCCGTCCGAGCTGCAGTCGCCACACGGCGGGCAGCCCCGGCCCAAG
CTACCGGGACTCTCGCATCCCGGGTTTACCGCTCCCGGCGCGGCGGCATACAGCCACGGGCGCACGCCGAGCGGG
ACGCAGCCCAGCGGCGACAGCGGCAACATGTTTGCGCAGAGCGACCCGAACGTCTGGGCCTATATCCAGACGTTG
GAGGACAAGGTCAAATTCTTGGCCGACAAAGTCACCCTGCTGGAACACGAGGTTCTGGGGCGGAAGAAGCAGCAC
GAGAACCGAGAGAGCCGCGATGGCGCGGCGGCGAGCACGTGA
Gene >Hirsu2|8354
ATGGCATCAGGCGCCGGCGCTCTTGCAGCAGAAGCGCCGCCCTTAGCTCGCCCGAGCGCCAACACCCCGCCCGGC
TCCCTCGCCTCTCCGGACGGCATCGCGAGGCTGCCCAAGCGACAGCGCGAGTCGGAGTCGGCGTCGCCGCGCGCC
CAGGCCGCCCAGGCCGCCCAGGCCTTCAATCCCCTGGGGTCGCCGACCAAGTCGGCCCGCCTGGCCCTTGCGACG
ACGGGCAGCAAGTCGCCCCCGCCCCTCACCGGCGCCGCCGCGCTCCAGGACGAGCGCTGGCGCAGGCGAGACGAG
TCTGCGCCCGCCTCCCCGGCCCCAACCAGTCCGAATCCCAGCCATCGGATCCTGGAATCCCTCATGTCCGCCGCC
ACCCAGGCTATGAGCCGTCCCGCCGACGCACCCCAGGTCGCGCCCACGGCCAACATGGACCCCACCGCCAAAGCC
GTCTCCGCCTTGTCGATACCCCCGAGCGGCCCTGCCCGCGCCGACGACCGCGCCGAGTCGAGTCCACAGAGCGCC
TCGAGCATGGTCGGCGTGCCGGTGACGGAGAGCCCGACGCCCATGGACGTCGACGGGGGCAAGGCTGACCAGCTG
TCCGCCCAGCAGGTCGCCGGCCACGACGAGCGGCCGCAACCGGGCTCCCTGTCGTACCCCGGATCTCTTCAGACG
CCCGGCGCCGTGACCGACCAGTCCATGCGCGGCATGAGCTTCCCCGCGCCCGGTCAGATTCAGGGCTCGCCGACT
TCGACGGGCGGCAAGAAGCACCGATGCCCCTACTGCCAGACCGAGTTCACGCGGCACCACAATCTCAAGAGCCAC
CTCCTGACGCACAGCCAGGAGAAGCCGTACGTCTGCACCGAGTGCCAGATGCGCTTCCGCCGCCTGCACGACCTC
AAGAGACACGGCAAGCTGCACACGGGCGAGAAGCCCCATGTGTGCCCCAAGTGCGACCGCAAGTTTGCCCGAGGG
GACGCCCTGGCCCGGCACAGCAAGGGCGCCGGCGGATGCGCGGGGCGAAGGGCCAGCATGGGCAGCTTTGTTGAG
GGGGACGAGCTGGACGGGGCCATGGGCGAAGGGGAAGAGACGGCCATGTCGGGCATCACCTACGAGAACGGCGAC
GACGAAGAGCTCAGACGCCAGAGCCTGCCCAGCCTGGGCTCGCAACACGCCCCCGGCGCGCAAGGCGACGCCTAT
AATGCCCACTCGCGCACGTATCCGCCGGCCGGGCCGCGACCCGCCGCGGGCGGCCTGTATCCTCCGAATGTCAAC
CCGGGCCAGGCGGCCGCCGGCAACAGCGGCACGTCGAGCCTGCCGAGCAGCTTGGCCAGCAGCAACACGGCCAAC
ACGAGCACGTCGTCTGGCCCCCCCGGCGGCGGCAACACCGGCCTGTTTTCGCAATCCGGCATGACGGAGAGCCCG
AAGCCGTTGAGCCCCGGCGCCCAGGCGCACGAGCCGTCCTCCAACGTGGCGCGGCAGCGATCGCCAAGCCTGACG
CAGCAGTTCCAGCAGCACATGGCTCGGAGGCCGTCCGAGCTGCAGTCGCCACACGGCGGGCAGCCCCGGCCCAAG
CTACCGGGACTCTCGCATCCCGGGTTTACCGCTCCCGGCGCGGCGGCATACAGCCACGGGCGCACGCCGAGCGGG
ACGCAGCCCAGCGGCGACAGCGGCAACATGTTTGCGCAGAGCGACCCGAACGTCTGGGCCTATATCCAGACGTTG
GAGGACAAGGTCAAATTCTTGGCCGACAAAGTCACCCTGCTGGAACACGAGGTTCTGGGGCGGAAGAAGCAGCAC
GAGAACCGAGAGAGCCGCGATGGCGCGGCGGCGAGCACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail