Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8342
Gene name
LocationContig_539:2314..3893
Strand-
Gene length (bp)1579
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 223 245 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8342
MRAGPEAVAAALLAVCRAAAALEVAPGSRCAARCLDAASGDRLEASASTTRDADVSCRDADYFTTDRGVKFRQCL
DCLQTSSQAAEGESDRGWYIYNLRYVLSTCLFSVPRAPLAGVASARCDPAKACKPLQASLSRRDYCTADNGSFTK
SNLSPCLSCLRAAEGGVSLSNFMAALEADCVDDGRLLRLNSSLFAPEAVSASGPTARGRDDETRPSGPSPGTVAG
IAVGIVSIFILAAALFALYWRRERAMDRENEEESEVGWPAATAGKDGSGSGGLLARLFASSGKTEAAGPVGRTVY
GSDHDGQKDGSHGGIPAHPAYIPFTASQATDGSGAGRAATPDAPKRTNRPDTFAMQAYLAAAEEAARLGPRPRAH
EHEPESEGRQRGRRPLASLPKLGVSRKRVAAKTTGGLELPVSEPMGAEGDGRRGWSLGEAARRSKHQHEDRPRRS
RQQQEDRPRRSRQQHEDADDGFIEVPLRSGKSTLYGY*
Coding >Hirsu2|8342
ATGAGGGCCGGGCCAGAAGCCGTAGCCGCCGCGCTCCTGGCCGTATGCCGCGCCGCCGCCGCTCTCGAGGTCGCG
CCGGGCTCCCGTTGTGCCGCGCGCTGCTTGGACGCTGCGAGCGGGGACAGGCTGGAGGCGTCGGCGTCGACAACA
CGGGACGCCGACGTCAGCTGCCGGGACGCCGACTACTTCACGACGGACCGGGGCGTCAAGTTCAGGCAATGCTTG
GACTGCCTGCAGACGAGCAGCCAGGCTGCGGAGGGGGAGTCGGACCGGGGGTGGTATATCTACAACCTTCGCTAC
GTCCTCAGCACCTGTCTCTTCTCCGTGCCCCGAGCACCTCTGGCCGGCGTCGCCAGCGCGCGGTGCGACCCGGCC
AAGGCTTGCAAGCCCCTGCAGGCCTCCCTCAGCAGGCGTGATTACTGCACGGCCGACAACGGGTCGTTTACGAAG
TCGAATCTGTCGCCGTGCCTCAGCTGTCTCCGTGCTGCCGAGGGGGGGGTCTCCCTCTCAAACTTCATGGCCGCT
CTCGAGGCCGACTGCGTGGACGACGGGCGCCTGCTGCGACTCAACAGCAGTCTCTTCGCCCCAGAGGCCGTTAGC
GCGAGCGGCCCCACGGCCCGCGGCCGAGATGACGAGACAAGGCCGTCCGGCCCCTCGCCCGGCACCGTTGCCGGC
ATTGCCGTAGGCATTGTTTCCATCTTCATCCTGGCCGCCGCCCTGTTCGCTCTGTACTGGAGGCGCGAGAGGGCC
ATGGACAGAGAGAATGAGGAGGAGTCGGAGGTCGGCTGGCCGGCGGCGACGGCCGGTAAAGACGGGTCCGGCAGC
GGCGGACTCTTGGCCCGCCTCTTCGCTTCCAGCGGCAAGACCGAGGCTGCCGGTCCGGTGGGCCGAACGGTGTAC
GGCTCGGACCACGACGGGCAGAAAGACGGGTCGCACGGCGGGATTCCCGCCCATCCGGCGTACATACCGTTCACG
GCCTCGCAGGCGACGGACGGCTCAGGCGCGGGACGAGCAGCGACGCCGGATGCGCCCAAGAGGACGAACAGGCCG
GACACGTTTGCGATGCAGGCGTACCTCGCGGCGGCGGAGGAGGCGGCGCGGCTGGGCCCTCGGCCGCGCGCGCAC
GAGCACGAGCCCGAGTCAGAAGGCAGGCAGAGAGGACGGAGGCCGCTGGCGTCTCTGCCGAAACTCGGCGTGTCG
AGGAAGCGCGTGGCGGCGAAGACGACAGGCGGACTTGAGCTGCCAGTCTCGGAGCCAATGGGAGCGGAGGGAGAT
GGTCGCCGTGGCTGGTCCCTCGGCGAGGCGGCACGACGGTCGAAGCACCAGCACGAGGACAGGCCACGACGGTCG
AGGCAACAGCAAGAGGACAGGCCACGACGGTCGAGGCAACAGCACGAGGACGCCGACGACGGTTTCATCGAGGTA
CCGCTGCGCAGCGGCAAGAGCACTCTCTACGGATACTAG
Transcript >Hirsu2|8342
ATGAGGGCCGGGCCAGAAGCCGTAGCCGCCGCGCTCCTGGCCGTATGCCGCGCCGCCGCCGCTCTCGAGGTCGCG
CCGGGCTCCCGTTGTGCCGCGCGCTGCTTGGACGCTGCGAGCGGGGACAGGCTGGAGGCGTCGGCGTCGACAACA
CGGGACGCCGACGTCAGCTGCCGGGACGCCGACTACTTCACGACGGACCGGGGCGTCAAGTTCAGGCAATGCTTG
GACTGCCTGCAGACGAGCAGCCAGGCTGCGGAGGGGGAGTCGGACCGGGGGTGGTATATCTACAACCTTCGCTAC
GTCCTCAGCACCTGTCTCTTCTCCGTGCCCCGAGCACCTCTGGCCGGCGTCGCCAGCGCGCGGTGCGACCCGGCC
AAGGCTTGCAAGCCCCTGCAGGCCTCCCTCAGCAGGCGTGATTACTGCACGGCCGACAACGGGTCGTTTACGAAG
TCGAATCTGTCGCCGTGCCTCAGCTGTCTCCGTGCTGCCGAGGGGGGGGTCTCCCTCTCAAACTTCATGGCCGCT
CTCGAGGCCGACTGCGTGGACGACGGGCGCCTGCTGCGACTCAACAGCAGTCTCTTCGCCCCAGAGGCCGTTAGC
GCGAGCGGCCCCACGGCCCGCGGCCGAGATGACGAGACAAGGCCGTCCGGCCCCTCGCCCGGCACCGTTGCCGGC
ATTGCCGTAGGCATTGTTTCCATCTTCATCCTGGCCGCCGCCCTGTTCGCTCTGTACTGGAGGCGCGAGAGGGCC
ATGGACAGAGAGAATGAGGAGGAGTCGGAGGTCGGCTGGCCGGCGGCGACGGCCGGTAAAGACGGGTCCGGCAGC
GGCGGACTCTTGGCCCGCCTCTTCGCTTCCAGCGGCAAGACCGAGGCTGCCGGTCCGGTGGGCCGAACGGTGTAC
GGCTCGGACCACGACGGGCAGAAAGACGGGTCGCACGGCGGGATTCCCGCCCATCCGGCGTACATACCGTTCACG
GCCTCGCAGGCGACGGACGGCTCAGGCGCGGGACGAGCAGCGACGCCGGATGCGCCCAAGAGGACGAACAGGCCG
GACACGTTTGCGATGCAGGCGTACCTCGCGGCGGCGGAGGAGGCGGCGCGGCTGGGCCCTCGGCCGCGCGCGCAC
GAGCACGAGCCCGAGTCAGAAGGCAGGCAGAGAGGACGGAGGCCGCTGGCGTCTCTGCCGAAACTCGGCGTGTCG
AGGAAGCGCGTGGCGGCGAAGACGACAGGCGGACTTGAGCTGCCAGTCTCGGAGCCAATGGGAGCGGAGGGAGAT
GGTCGCCGTGGCTGGTCCCTCGGCGAGGCGGCACGACGGTCGAAGCACCAGCACGAGGACAGGCCACGACGGTCG
AGGCAACAGCAAGAGGACAGGCCACGACGGTCGAGGCAACAGCACGAGGACGCCGACGACGGTTTCATCGAGGTA
CCGCTGCGCAGCGGCAAGAGCACTCTCTACGGATACTAG
Gene >Hirsu2|8342
ATGAGGGCCGGGCCAGAAGCCGTAGCCGCCGCGCTCCTGGCCGTATGCCGCGCCGCCGCCGCTCTCGAGGTCGCG
CCGGGCTCCCGTTGTGCCGCGCGCTGCTTGGACGCTGCGAGCGGGGACAGGCTGGAGGCGTCGGCGTCGACAACA
CGGGACGCCGACGTCAGCTGCCGGGACGCCGACTACTTCACGACGGACCGGGGCGTCAAGTTCAGGCAATGCTTG
GACTGCCTGCAGACGAGCAGCCAGGCTGCGGAGGGGGAGTCGGACCGGGGGTGGTATATCTGTACGCCTCCACGT
CGTCGGCCGGCGCTGCCGCCCTCTTCTAACGTCCGTTTCTGCAAAGACAACCTTCGCTACGTCCTCAGCACCTGT
CTCTTCTCCGTGCCCCGAGCACCTCTGGCCGGCGTCGCCAGCGCGCGGTGCGACCCGGCCAAGGCTTGCAAGCCC
CTGCAGGCCTCCCTCAGCAGGCGTGATTACTGCACGGCCGACAACGGGTCGTTTACGAAGTCGAATCTGTCGCCG
TGCCTCAGCTGTCTCCGTGCTGCCGAGGGGGGGGTCTCCCTCTCAAACTGTAAGGTGTCCGTCGTGGGACGCTTC
GGCGCCGTAGGCTGACTGGCGTGTCTTAGTCATGGCCGCTCTCGAGGCCGACTGCGTGGACGACGGGCGCCTGCT
GCGACTCAACAGCAGTCTCTTCGCCCCAGAGGCCGTTAGCGCGAGCGGCCCCACGGCCCGCGGCCGAGATGACGA
GACAAGGCCGTCCGGCCCCTCGCCCGGCACCGTTGCCGGCATTGCCGTAGGCATTGTTTCCATCTTCATCCTGGC
CGCCGCCCTGTTCGCTCTGTACTGGAGGCGCGAGAGGGCCATGGACAGAGAGAATGAGGAGGAGTCGGAGGTCGG
CTGGCCGGCGGCGACGGCCGGTAAAGACGGGTCCGGCAGCGGCGGACTCTTGGCCCGCCTCTTCGCTTCCAGCGG
CAAGACCGAGGCTGCCGGTCCGGTGGGCCGAACGGTGTACGGCTCGGACCACGACGGGCAGAAAGACGGGTCGCA
CGGCGGGATTCCCGCCCATCCGGCGTACATACCGTTCACGGCCTCGCAGGCGACGGACGGCTCAGGCGCGGGACG
AGCAGCGACGCCGGATGCGCCCAAGAGGACGAACAGGCCGGACACGTTTGCGATGCAGGCGTACCTCGCGGCGGC
GGAGGAGGCGGCGCGGCTGGGCCCTCGGCCGCGCGCGCACGAGCACGAGCCCGAGTCAGAAGGCAGGCAGAGAGG
ACGGAGGCCGCTGGCGTCTCTGCCGAAACTCGGCGTGTCGAGGAAGCGCGTGGCGGCGAAGACGACAGGCGGACT
TGAGCTGCCAGTCTCGGAGCCAATGGGAGCGGAGGGAGATGGTCGCCGTGGCTGGTCCCTCGGCGAGGCGGCACG
ACGGTCGAAGCACCAGCACGAGGACAGGCCACGACGGTCGAGGCAACAGCAAGAGGACAGGCCACGACGGTCGAG
GCAACAGCACGAGGACGCCGACGACGGTTTCATCGAGGTACCGCTGCGCAGCGGCAAGAGCACTCTCTACGGATA
CTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail