Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8337
Gene name
LocationContig_538:5446..6222
Strand+
Gene length (bp)776
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00025 Arf ADP-ribosylation factor family 1.7E-74 7 176
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 8.5E-15 19 129
PF09439 SRPRB Signal recognition particle receptor beta subunit 5.8E-14 17 144
PF00071 Ras Ras family 1.5E-11 19 178
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 1.3E-08 19 130
PF01926 MMR_HSR1 50S ribosome-binding GTPase 5.4E-07 19 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38116|ARL1_YEAST ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL1 PE=1 SV=4 1 180 1.0E-87
sp|Q96361|ARF1_BRARP ADP-ribosylation factor 1 OS=Brassica rapa subsp. pekinensis GN=ARF1 PE=2 SV=3 1 177 1.0E-74
sp|P61212|ARL1_RAT ADP-ribosylation factor-like protein 1 OS=Rattus norvegicus GN=Arl1 PE=1 SV=1 16 178 4.0E-74
sp|P61211|ARL1_MOUSE ADP-ribosylation factor-like protein 1 OS=Mus musculus GN=Arl1 PE=1 SV=1 16 178 4.0E-74
sp|P40940|ARF3_ARATH ADP-ribosylation factor 3 OS=Arabidopsis thaliana GN=ARF3 PE=1 SV=2 1 177 6.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38116|ARL1_YEAST ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL1 PE=1 SV=4 1 180 1.0E-87
sp|Q96361|ARF1_BRARP ADP-ribosylation factor 1 OS=Brassica rapa subsp. pekinensis GN=ARF1 PE=2 SV=3 1 177 1.0E-74
sp|P61212|ARL1_RAT ADP-ribosylation factor-like protein 1 OS=Rattus norvegicus GN=Arl1 PE=1 SV=1 16 178 4.0E-74
sp|P61211|ARL1_MOUSE ADP-ribosylation factor-like protein 1 OS=Mus musculus GN=Arl1 PE=1 SV=1 16 178 4.0E-74
sp|P40940|ARF3_ARATH ADP-ribosylation factor 3 OS=Arabidopsis thaliana GN=ARF3 PE=1 SV=2 1 177 6.0E-74
sp|P40616|ARL1_HUMAN ADP-ribosylation factor-like protein 1 OS=Homo sapiens GN=ARL1 PE=1 SV=1 16 177 6.0E-74
sp|Q2YDM1|ARL1_BOVIN ADP-ribosylation factor-like protein 1 OS=Bos taurus GN=ARL1 PE=2 SV=1 16 178 1.0E-73
sp|P51644|ARF4_XENLA ADP-ribosylation factor 4 OS=Xenopus laevis GN=arf4 PE=1 SV=2 1 179 2.0E-73
sp|Q94650|ARF1_PLAFA ADP-ribosylation factor 1 OS=Plasmodium falciparum GN=ARF1 PE=1 SV=3 1 173 4.0E-73
sp|Q7KQL3|ARF1_PLAF7 ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate 3D7) GN=ARF1 PE=1 SV=1 1 173 4.0E-73
sp|P51823|ARF2_ORYSJ ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2 1 180 5.0E-73
sp|Q06396|ARF1_ORYSJ ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3 1 180 7.0E-73
sp|P0DH91|ARF2B_ARATH ADP-ribosylation factor 2-B OS=Arabidopsis thaliana GN=ARF2-B PE=2 SV=1 1 178 2.0E-72
sp|Q9LQC8|ARF2A_ARATH ADP-ribosylation factor 2-A OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=2 1 178 2.0E-72
sp|P91924|ARF_DUGJA ADP-ribosylation factor OS=Dugesia japonica PE=2 SV=3 1 178 2.0E-72
sp|P36579|ARF1_SCHPO ADP-ribosylation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf1 PE=2 SV=2 1 173 2.0E-72
sp|P36397|ARF1_ARATH ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2 1 180 2.0E-72
sp|P51822|ARF1_DAUCA ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2 1 180 3.0E-72
sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2 1 180 3.0E-72
sp|O48920|ARF_VIGUN ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3 1 180 5.0E-72
sp|P51824|ARF1_SOLTU ADP-ribosylation factor 1 OS=Solanum tuberosum PE=2 SV=2 1 180 5.0E-72
sp|P84083|ARF5_RAT ADP-ribosylation factor 5 OS=Rattus norvegicus GN=Arf5 PE=1 SV=2 1 180 5.0E-72
sp|P84084|ARF5_MOUSE ADP-ribosylation factor 5 OS=Mus musculus GN=Arf5 PE=1 SV=2 1 180 5.0E-72
sp|P84085|ARF5_HUMAN ADP-ribosylation factor 5 OS=Homo sapiens GN=ARF5 PE=1 SV=2 1 180 5.0E-72
sp|Q3SZF2|ARF4_BOVIN ADP-ribosylation factor 4 OS=Bos taurus GN=ARF4 PE=2 SV=3 1 179 5.0E-72
sp|P0CM16|ARF_CRYNJ ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ARF PE=1 SV=1 1 173 6.0E-72
sp|P0CM17|ARF_CRYNB ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ARF PE=3 SV=1 1 173 6.0E-72
sp|Q25761|ARF1_PLAFO ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate NF54) GN=ARF1 PE=2 SV=2 1 173 7.0E-72
sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3 1 180 8.0E-72
sp|O00909|ARF1_DICDI ADP-ribosylation factor 1 OS=Dictyostelium discoideum GN=arfA PE=1 SV=3 1 178 8.0E-72
sp|P40945|ARF2_DROME ADP-ribosylation factor 2 OS=Drosophila melanogaster GN=Arf102F PE=2 SV=2 1 173 1.0E-71
sp|P49702|ARF5_CHICK ADP-ribosylation factor 5 OS=Gallus gallus GN=ARF5 PE=2 SV=2 1 179 1.0E-71
sp|P25160|ARL1_DROME ADP-ribosylation factor-like protein 1 OS=Drosophila melanogaster GN=Arl1 PE=2 SV=5 1 177 6.0E-71
sp|P51643|ARF1_XENLA ADP-ribosylation factor 1 OS=Xenopus laevis GN=arf1 PE=2 SV=2 1 173 9.0E-71
sp|P51821|ARF1_CHLRE ADP-ribosylation factor 1 OS=Chlamydomonas reinhardtii GN=ARF1 PE=2 SV=2 1 180 1.0E-70
sp|P84079|ARF1_RAT ADP-ribosylation factor 1 OS=Rattus norvegicus GN=Arf1 PE=1 SV=2 1 173 1.0E-70
sp|P84078|ARF1_MOUSE ADP-ribosylation factor 1 OS=Mus musculus GN=Arf1 PE=1 SV=2 1 173 1.0E-70
sp|Q4R5P2|ARF1_MACFA ADP-ribosylation factor 1 OS=Macaca fascicularis GN=ARF1 PE=2 SV=3 1 173 1.0E-70
sp|P84077|ARF1_HUMAN ADP-ribosylation factor 1 OS=Homo sapiens GN=ARF1 PE=1 SV=2 1 173 1.0E-70
sp|P84080|ARF1_BOVIN ADP-ribosylation factor 1 OS=Bos taurus GN=ARF1 PE=1 SV=2 1 173 1.0E-70
sp|P84082|ARF2_RAT ADP-ribosylation factor 2 OS=Rattus norvegicus GN=Arf2 PE=2 SV=1 1 173 1.0E-70
sp|Q8BSL7|ARF2_MOUSE ADP-ribosylation factor 2 OS=Mus musculus GN=Arf2 PE=1 SV=2 1 173 1.0E-70
sp|P84081|ARF2_BOVIN ADP-ribosylation factor 2 OS=Bos taurus GN=ARF2 PE=2 SV=1 1 173 1.0E-70
sp|Q7RVM2|ARF_NEUCR ADP-ribosylation factor OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08340 PE=3 SV=3 1 173 1.0E-70
sp|P61210|ARF1_LOCMI ADP-ribosylation factor 1 OS=Locusta migratoria GN=ARF1 PE=2 SV=2 1 173 2.0E-70
sp|P61209|ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster GN=Arf79F PE=2 SV=2 1 173 2.0E-70
sp|P61207|ARF3_TAKRU ADP-ribosylation factor 3 OS=Takifugu rubripes GN=arf3 PE=3 SV=2 1 180 5.0E-70
sp|P61206|ARF3_RAT ADP-ribosylation factor 3 OS=Rattus norvegicus GN=Arf3 PE=2 SV=2 1 180 5.0E-70
sp|Q5R5P7|ARF3_PONAB ADP-ribosylation factor 3 OS=Pongo abelii GN=ARF3 PE=2 SV=3 1 180 5.0E-70
sp|P61205|ARF3_MOUSE ADP-ribosylation factor 3 OS=Mus musculus GN=Arf3 PE=2 SV=2 1 180 5.0E-70
sp|P61204|ARF3_HUMAN ADP-ribosylation factor 3 OS=Homo sapiens GN=ARF3 PE=1 SV=2 1 180 5.0E-70
sp|Q5E9I6|ARF3_BOVIN ADP-ribosylation factor 3 OS=Bos taurus GN=ARF3 PE=2 SV=3 1 180 5.0E-70
sp|O23778|ARF1_CATRO ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3 1 180 5.0E-70
sp|Q20758|ARL1_CAEEL ADP-ribosylation factor-like protein 1 OS=Caenorhabditis elegans GN=arl-1 PE=3 SV=2 1 180 6.0E-70
sp|P22274|ARF_CANAL ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARF1 PE=3 SV=4 1 179 2.0E-69
sp|Q61LA8|ARF12_CAEBR ADP-ribosylation factor 1-like 2 OS=Caenorhabditis briggsae GN=arf-1.2 PE=3 SV=3 1 173 3.0E-69
sp|Q5RCF1|ARF4_PONAB ADP-ribosylation factor 4 OS=Pongo abelii GN=ARF4 PE=2 SV=3 1 180 3.0E-69
sp|P18085|ARF4_HUMAN ADP-ribosylation factor 4 OS=Homo sapiens GN=ARF4 PE=1 SV=3 1 180 3.0E-69
sp|Q75A26|ARF_ASHGO ADP-ribosylation factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARF1 PE=3 SV=3 1 173 3.0E-69
sp|P61751|ARF4_RAT ADP-ribosylation factor 4 OS=Rattus norvegicus GN=Arf4 PE=2 SV=2 1 180 4.0E-69
sp|P61750|ARF4_MOUSE ADP-ribosylation factor 4 OS=Mus musculus GN=Arf4 PE=1 SV=2 1 180 4.0E-69
sp|P34727|ARF_AJECA ADP-ribosylation factor OS=Ajellomyces capsulatus GN=ARF PE=1 SV=3 1 179 6.0E-69
sp|Q10943|ARF12_CAEEL ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans GN=arf-1.2 PE=2 SV=2 1 173 7.0E-69
sp|P26991|ARF_GIAIN ADP-ribosylation factor OS=Giardia intestinalis PE=3 SV=3 1 173 9.0E-68
sp|P11076|ARF1_YEAST ADP-ribosylation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF1 PE=1 SV=3 1 177 3.0E-66
sp|P19146|ARF2_YEAST ADP-ribosylation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF2 PE=1 SV=3 1 180 4.0E-65
sp|P62332|ARF6_RAT ADP-ribosylation factor 6 OS=Rattus norvegicus GN=Arf6 PE=1 SV=2 10 173 7.0E-64
sp|Q007T5|ARF6_PIG ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE=2 SV=1 10 173 7.0E-64
sp|P62331|ARF6_MOUSE ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 PE=1 SV=2 10 173 7.0E-64
sp|P62330|ARF6_HUMAN ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2 10 173 7.0E-64
sp|P26990|ARF6_CHICK ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6 PE=2 SV=3 10 173 9.0E-64
sp|P40946|ARF3_DROME ADP-ribosylation factor 3 OS=Drosophila melanogaster GN=Arf51F PE=2 SV=3 8 173 1.0E-63
sp|P51645|ARF6_XENLA ADP-ribosylation factor 6 OS=Xenopus laevis GN=arf6 PE=2 SV=2 8 173 5.0E-63
sp|Q54V47|ARFJ_DICDI ADP-ribosylation factor J OS=Dictyostelium discoideum GN=arrJ PE=3 SV=1 1 180 9.0E-63
sp|Q9Y7Z2|ARF6_SCHPO ADP-ribosylation factor 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf6 PE=3 SV=1 10 175 4.0E-61
sp|Q94231|ARF11_CAEEL ADP-ribosylation factor 1-like 1 OS=Caenorhabditis elegans GN=arf-1.1 PE=3 SV=3 1 173 8.0E-61
sp|Q54JJ3|ARFH_DICDI ADP-ribosylation factor H OS=Dictyostelium discoideum GN=arrH PE=3 SV=1 1 180 6.0E-60
sp|Q9SHU5|ARF4_ARATH Probable ADP-ribosylation factor At2g15310 OS=Arabidopsis thaliana GN=At2g15310 PE=2 SV=3 1 180 2.0E-59
sp|Q54V41|ARFK_DICDI ADP-ribosylation factor K OS=Dictyostelium discoideum GN=arrK PE=3 SV=1 1 180 4.0E-59
sp|B5FYQ0|ARL3_TAEGU ADP-ribosylation factor-like protein 3 OS=Taeniopygia guttata GN=ARL3 PE=2 SV=1 16 178 1.0E-55
sp|Q54HK2|ARFF_DICDI ADP-ribosylation factor F OS=Dictyostelium discoideum GN=arrF PE=3 SV=1 10 178 3.0E-55
sp|Q8QHI3|ARL3_XENLA ADP-ribosylation factor-like protein 3 OS=Xenopus laevis GN=arl3 PE=2 SV=1 16 178 3.0E-55
sp|Q1MTE5|ARL3_DANRE ADP-ribosylation factor-like protein 3 OS=Danio rerio GN=arl3 PE=2 SV=1 16 178 4.0E-55
sp|A8ISN6|ARL3_CHLRE ADP-ribosylation factor-like protein 3 OS=Chlamydomonas reinhardtii GN=ARL3 PE=1 SV=2 17 177 5.0E-55
sp|P36407|TRI23_RAT E3 ubiquitin-protein ligase TRIM23 OS=Rattus norvegicus GN=Trim23 PE=2 SV=2 15 173 2.0E-54
sp|Q8BGX0|TRI23_MOUSE E3 ubiquitin-protein ligase TRIM23 OS=Mus musculus GN=Trim23 PE=2 SV=1 15 173 2.0E-54
sp|P36406|TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens GN=TRIM23 PE=1 SV=1 15 173 2.0E-54
sp|P40994|ARF3_YEAST ADP-ribosylation factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF3 PE=1 SV=2 1 173 2.0E-54
sp|Q9D4P0|ARL5B_MOUSE ADP-ribosylation factor-like protein 5B OS=Mus musculus GN=Arl5b PE=2 SV=3 12 177 6.0E-54
sp|Q96KC2|ARL5B_HUMAN ADP-ribosylation factor-like protein 5B OS=Homo sapiens GN=ARL5B PE=1 SV=1 12 177 6.0E-54
sp|Q80ZU0|ARL5A_MOUSE ADP-ribosylation factor-like protein 5A OS=Mus musculus GN=Arl5a PE=1 SV=1 12 174 9.0E-54
sp|Q2KJ96|ARL5A_BOVIN ADP-ribosylation factor-like protein 5A OS=Bos taurus GN=ARL5A PE=2 SV=1 12 174 1.0E-53
sp|P51646|ARL5A_RAT ADP-ribosylation factor-like protein 5A OS=Rattus norvegicus GN=Arl5a PE=2 SV=1 12 174 2.0E-52
sp|Q9Y689|ARL5A_HUMAN ADP-ribosylation factor-like protein 5A OS=Homo sapiens GN=ARL5A PE=1 SV=1 12 174 2.0E-52
sp|Q9D0J4|ARL2_MOUSE ADP-ribosylation factor-like protein 2 OS=Mus musculus GN=Arl2 PE=1 SV=1 8 178 3.0E-52
sp|O08697|ARL2_RAT ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus GN=Arl2 PE=1 SV=1 8 178 7.0E-52
sp|Q2TA37|ARL2_BOVIN ADP-ribosylation factor-like protein 2 OS=Bos taurus GN=ARL2 PE=1 SV=1 8 178 1.0E-51
sp|P36404|ARL2_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens GN=ARL2 PE=1 SV=4 8 178 1.0E-51
sp|Q54I24|ARFD_DICDI ADP-ribosylation factor D OS=Dictyostelium discoideum GN=arrD PE=3 SV=2 1 173 8.0E-51
sp|O45379|ARL3_CAEEL ADP-ribosylation factor-like protein 3 OS=Caenorhabditis elegans GN=arl-3 PE=1 SV=1 16 173 7.0E-50
sp|P34212|ARL5_CAEEL ADP-ribosylation factor-like protein 5 OS=Caenorhabditis elegans GN=arl-5 PE=3 SV=3 1 173 2.0E-49
sp|Q55AD9|ARL5_DICDI ADP-ribosylation factor-like protein 5 OS=Dictyostelium discoideum GN=arl5 PE=3 SV=1 1 179 2.0E-49
sp|Q2TBW6|ARL3_BOVIN ADP-ribosylation factor-like protein 3 OS=Bos taurus GN=ARL3 PE=2 SV=1 16 178 1.0E-48
sp|P37996|ARL3_RAT ADP-ribosylation factor-like protein 3 OS=Rattus norvegicus GN=Arl3 PE=1 SV=2 16 178 2.0E-48
sp|Q627K4|ARL2_CAEBR ADP-ribosylation factor-like protein 2 OS=Caenorhabditis briggsae GN=evl-20.1 PE=3 SV=1 15 177 2.0E-48
sp|Q9WUL7|ARL3_MOUSE ADP-ribosylation factor-like protein 3 OS=Mus musculus GN=Arl3 PE=1 SV=1 16 178 3.0E-48
sp|Q52NJ4|ARL3_PIG ADP-ribosylation factor-like protein 3 OS=Sus scrofa GN=ARL3 PE=2 SV=1 16 178 5.0E-48
sp|Q19705|ARL2_CAEEL ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans GN=evl-20 PE=2 SV=2 15 177 6.0E-48
sp|P36405|ARL3_HUMAN ADP-ribosylation factor-like protein 3 OS=Homo sapiens GN=ARL3 PE=1 SV=2 16 178 2.0E-47
sp|Q6P068|ARL5C_MOUSE ADP-ribosylation factor-like protein 5C OS=Mus musculus GN=Arl5c PE=2 SV=1 12 173 4.0E-47
sp|Q06849|ARL2_DROME ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster GN=Arl2 PE=2 SV=2 8 179 4.0E-47
sp|Q54UF1|ARL2_DICDI ADP-ribosylation factor-like protein 2 OS=Dictyostelium discoideum GN=arl2 PE=3 SV=1 19 177 7.0E-47
sp|Q8N4G2|ARL14_HUMAN ADP-ribosylation factor-like protein 14 OS=Homo sapiens GN=ARL14 PE=1 SV=2 16 174 5.0E-46
sp|Q9ZPX1|ARF5_ARATH ADP-ribosylation factor-like protein 2 OS=Arabidopsis thaliana GN=ARL2 PE=2 SV=1 18 178 2.0E-45
sp|Q3SXC5|ARL14_MOUSE ADP-ribosylation factor-like protein 14 OS=Mus musculus GN=Arl14 PE=2 SV=1 16 175 2.0E-42
sp|Q99PE9|ARL4D_MOUSE ADP-ribosylation factor-like protein 4D OS=Mus musculus GN=Arl4d PE=2 SV=2 9 177 2.0E-42
sp|A6NH57|ARL5C_HUMAN Putative ADP-ribosylation factor-like protein 5C OS=Homo sapiens GN=ARL5C PE=3 SV=4 1 173 3.0E-41
sp|P61208|ARL4C_MOUSE ADP-ribosylation factor-like protein 4C OS=Mus musculus GN=Arl4c PE=2 SV=1 8 177 2.0E-40
sp|P56559|ARL4C_HUMAN ADP-ribosylation factor-like protein 4C OS=Homo sapiens GN=ARL4C PE=1 SV=1 8 177 2.0E-40
sp|Q9H0F7|ARL6_HUMAN ADP-ribosylation factor-like protein 6 OS=Homo sapiens GN=ARL6 PE=1 SV=1 8 177 1.0E-38
sp|Q0IIM2|ARL6_BOVIN ADP-ribosylation factor-like protein 6 OS=Bos taurus GN=ARL6 PE=1 SV=1 8 173 1.0E-38
sp|Q5R4G5|ARL6_PONAB ADP-ribosylation factor-like protein 6 OS=Pongo abelii GN=ARL6 PE=2 SV=1 15 177 1.0E-38
sp|O88848|ARL6_MOUSE ADP-ribosylation factor-like protein 6 OS=Mus musculus GN=Arl6 PE=1 SV=1 8 173 2.0E-38
sp|Q5RCQ6|ARL3_PONAB ADP-ribosylation factor-like protein 3 OS=Pongo abelii GN=ARL3 PE=2 SV=1 16 178 3.0E-38
sp|Q5M9P8|ARL6_DANRE ADP-ribosylation factor-like protein 6 OS=Danio rerio GN=arl6 PE=2 SV=1 15 173 1.0E-37
sp|Q58DI9|ARL11_BOVIN ADP-ribosylation factor-like protein 11 OS=Bos taurus GN=ARL11 PE=2 SV=1 15 173 1.0E-37
sp|P61214|ARL4A_RAT ADP-ribosylation factor-like protein 4A OS=Rattus norvegicus GN=Arl4a PE=2 SV=1 6 173 2.0E-37
sp|P61213|ARL4A_MOUSE ADP-ribosylation factor-like protein 4A OS=Mus musculus GN=Arl4a PE=2 SV=1 6 173 2.0E-37
sp|Q3T0M9|ARL4A_BOVIN ADP-ribosylation factor-like protein 4A OS=Bos taurus GN=ARL4A PE=2 SV=1 6 173 2.0E-37
sp|Q09767|ARL_SCHPO ADP-ribosylation factor-like protein alp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp41 PE=3 SV=1 15 179 2.0E-37
sp|Q5REU3|ARL4D_PONAB ADP-ribosylation factor-like protein 4D OS=Pongo abelii GN=ARL4D PE=2 SV=1 9 177 2.0E-37
sp|P49703|ARL4D_HUMAN ADP-ribosylation factor-like protein 4D OS=Homo sapiens GN=ARL4D PE=1 SV=2 9 177 2.0E-37
sp|P40617|ARL4A_HUMAN ADP-ribosylation factor-like protein 4A OS=Homo sapiens GN=ARL4A PE=1 SV=2 1 173 3.0E-37
sp|Q969Q4|ARL11_HUMAN ADP-ribosylation factor-like protein 11 OS=Homo sapiens GN=ARL11 PE=1 SV=1 15 173 4.0E-37
sp|Q0VC18|ARL4D_BOVIN ADP-ribosylation factor-like protein 4D OS=Bos taurus GN=ARL4D PE=2 SV=1 9 177 5.0E-37
sp|Q6P3A9|ARL11_MOUSE ADP-ribosylation factor-like protein 11 OS=Mus musculus GN=Arl11 PE=2 SV=1 15 175 5.0E-37
sp|Q5BK71|ARL11_RAT ADP-ribosylation factor-like protein 11 OS=Rattus norvegicus GN=Arl11 PE=2 SV=1 19 175 3.0E-35
sp|Q18510|ARL6_CAEEL ADP-ribosylation factor-like protein 6 OS=Caenorhabditis elegans GN=arl-6 PE=2 SV=1 6 179 2.0E-33
sp|Q0UKC0|SAR1_PHANO Small COPII coat GTPase SAR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SAR1 PE=3 SV=2 8 177 4.0E-32
sp|Q60Z38|ARL6_CAEBR ADP-ribosylation factor-like protein 6 OS=Caenorhabditis briggsae GN=arl-6 PE=3 SV=1 5 173 4.0E-32
sp|Q4P0I7|SAR1_USTMA Small COPII coat GTPase SAR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SAR1 PE=3 SV=1 8 177 1.0E-31
sp|Q54R04|ARL8_DICDI ADP-ribosylation factor-like protein 8 OS=Dictyostelium discoideum GN=arl8 PE=3 SV=1 5 178 1.0E-30
sp|P78976|SAR1_HYPJE Small COPII coat GTPase sar1 OS=Hypocrea jecorina GN=sar1 PE=3 SV=1 8 177 1.0E-30
sp|Q23445|SAR1_CAEEL GTP-binding protein SAR1 OS=Caenorhabditis elegans GN=ZK180.4 PE=3 SV=1 8 175 2.0E-30
sp|Q01475|SAR1_SCHPO Small COPII coat GTPase sar1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sar1 PE=1 SV=1 8 177 2.0E-30
sp|Q32LJ2|ARFRP_BOVIN ADP-ribosylation factor-related protein 1 OS=Bos taurus GN=ARFRP1 PE=2 SV=1 1 177 3.0E-30
sp|Q63055|ARFRP_RAT ADP-ribosylation factor-related protein 1 OS=Rattus norvegicus GN=Arfrp1 PE=2 SV=1 1 177 4.0E-30
sp|Q8BXL7|ARFRP_MOUSE ADP-ribosylation factor-related protein 1 OS=Mus musculus GN=Arfrp1 PE=1 SV=2 1 177 4.0E-30
sp|Q96BM9|ARL8A_HUMAN ADP-ribosylation factor-like protein 8A OS=Homo sapiens GN=ARL8A PE=1 SV=1 5 175 7.0E-30
sp|Q5ZKQ8|ARL8A_CHICK ADP-ribosylation factor-like protein 8A OS=Gallus gallus GN=ARL8A PE=2 SV=1 5 175 9.0E-30
sp|Q01474|SAR1B_ARATH GTP-binding protein SAR1B OS=Arabidopsis thaliana GN=SAR1B PE=1 SV=1 8 178 9.0E-30
sp|A1CRG9|SAR1_ASPCL Small COPII coat GTPase sar1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sar1 PE=3 SV=1 8 177 1.0E-29
sp|O04266|SAR1A_BRACM GTP-binding protein SAR1A OS=Brassica campestris GN=SAR1A PE=2 SV=1 8 178 1.0E-29
sp|Q9VHV5|ARL8_DROME ADP-ribosylation factor-like protein 8 OS=Drosophila melanogaster GN=Gie PE=1 SV=1 5 175 2.0E-29
sp|Q4WJS7|SAR1_ASPFU Small COPII coat GTPase sar1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sar1 PE=3 SV=1 8 177 2.0E-29
sp|A1D4D1|SAR1_NEOFI Small COPII coat GTPase sar1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sar1 PE=3 SV=1 8 177 2.0E-29
sp|P52884|SAR2_SOLLC GTP-binding protein SAR2 OS=Solanum lycopersicum GN=SAR2 PE=2 SV=1 8 178 2.0E-29
sp|P0CT17|SAR1_MAGOY Small COPII coat GTPase SAR1 OS=Magnaporthe oryzae (strain Y34) GN=SAR1 PE=2 SV=1 8 177 2.0E-29
sp|P0CT16|SAR1_MAGO7 Small COPII coat GTPase SAR1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SAR1 PE=3 SV=1 8 177 2.0E-29
sp|Q2HA55|SAR1_CHAGB Small COPII coat GTPase SAR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SAR1 PE=3 SV=2 8 173 2.0E-29
sp|Q5R579|ARFRP_PONAB ADP-ribosylation factor-related protein 1 OS=Pongo abelii GN=ARFRP1 PE=2 SV=1 1 177 2.0E-29
sp|Q13795|ARFRP_HUMAN ADP-ribosylation factor-related protein 1 OS=Homo sapiens GN=ARFRP1 PE=1 SV=1 1 177 2.0E-29
sp|O04267|SAR1B_BRACM GTP-binding protein SAR1B OS=Brassica campestris GN=SAR1B PE=2 SV=1 8 178 2.0E-29
sp|P0CR30|SAR1_CRYNJ Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SAR1 PE=3 SV=1 8 177 3.0E-29
sp|P0CR31|SAR1_CRYNB Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SAR1 PE=3 SV=1 8 177 3.0E-29
sp|O04834|SAR1A_ARATH GTP-binding protein SAR1A OS=Arabidopsis thaliana GN=SAR1A PE=2 SV=1 8 178 3.0E-29
sp|P20606|SAR1_YEAST Small COPII coat GTPase SAR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAR1 PE=1 SV=1 8 177 4.0E-29
sp|Q6P8C8|ARL8A_XENTR ADP-ribosylation factor-like protein 8A OS=Xenopus tropicalis GN=arl8a PE=2 SV=1 5 175 6.0E-29
sp|Q6NZW8|AR8BA_DANRE ADP-ribosylation factor-like protein 8B-A OS=Danio rerio GN=arl8ba PE=2 SV=1 5 175 7.0E-29
sp|Q0CUN7|SAR1_ASPTN Small COPII coat GTPase sar1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sar1 PE=3 SV=1 8 177 7.0E-29
sp|P0C583|SAR1_NEUCR Small COPII coat GTPase sar1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vtr-7 PE=3 SV=1 8 177 8.0E-29
sp|Q877B9|SAR1_ASPOR Small COPII coat GTPase sar1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sar1 PE=3 SV=1 8 177 8.0E-29
sp|Q66HA6|ARL8B_RAT ADP-ribosylation factor-like protein 8B OS=Rattus norvegicus GN=Arl8b PE=2 SV=1 5 175 9.0E-29
sp|Q9CQW2|ARL8B_MOUSE ADP-ribosylation factor-like protein 8B OS=Mus musculus GN=Arl8b PE=1 SV=1 5 175 9.0E-29
sp|Q9NVJ2|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B OS=Homo sapiens GN=ARL8B PE=1 SV=1 5 175 9.0E-29
sp|P0C951|SAR1_ASPNC Small COPII coat GTPase SAR1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sar1 PE=3 SV=1 8 177 1.0E-28
sp|A3LTA2|SAR1_PICST Small COPII coat GTPase SAR1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SAR1 PE=3 SV=1 8 177 1.0E-28
sp|Q5BGB9|SAR1_EMENI Small COPII coat GTPase sar1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sar1 PE=3 SV=1 8 177 1.0E-28
sp|Q4R4S4|ARL8B_MACFA ADP-ribosylation factor-like protein 8B OS=Macaca fascicularis GN=ARL8B PE=2 SV=1 5 175 2.0E-28
sp|A8INQ0|ARL13_CHLRE ADP-ribosylation factor-like protein 13B OS=Chlamydomonas reinhardtii GN=ARL13 PE=1 SV=1 15 180 2.0E-28
sp|Q8VEH3|ARL8A_MOUSE ADP-ribosylation factor-like protein 8A OS=Mus musculus GN=Arl8a PE=1 SV=1 5 175 2.0E-28
sp|Q2KI07|ARL8B_BOVIN ADP-ribosylation factor-like protein 8B OS=Bos taurus GN=ARL8B PE=2 SV=1 5 175 5.0E-28
sp|Q02804|ARL3_YEAST ADP-ribosylation factor-like protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL3 PE=1 SV=1 13 174 6.0E-28
sp|Q6CB54|SAR1_YARLI Small COPII coat GTPase SAR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SAR1 PE=3 SV=1 8 177 1.0E-27
sp|Q6FUZ9|SAR1_CANGA Small COPII coat GTPase SAR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SAR1 PE=3 SV=1 8 177 1.0E-27
sp|Q3SXY8|AR13B_HUMAN ADP-ribosylation factor-like protein 13B OS=Homo sapiens GN=ARL13B PE=1 SV=1 1 180 1.0E-27
sp|Q59S78|SAR1_CANAL Small COPII coat GTPase SAR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAR1 PE=3 SV=2 8 177 2.0E-27
sp|Q755D7|SAR1_ASHGO Small COPII coat GTPase SAR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SAR1 PE=3 SV=1 8 177 2.0E-27
sp|Q5R6E7|ARL8B_PONAB ADP-ribosylation factor-like protein 8B OS=Pongo abelii GN=ARL8B PE=2 SV=1 5 175 2.0E-27
sp|Q9CQC9|SAR1B_MOUSE GTP-binding protein SAR1b OS=Mus musculus GN=Sar1b PE=1 SV=1 6 177 3.0E-27
sp|Q9Y6B6|SAR1B_HUMAN GTP-binding protein SAR1b OS=Homo sapiens GN=SAR1B PE=1 SV=1 6 177 3.0E-27
sp|Q9QVY3|SAR1B_CRIGR GTP-binding protein SAR1b OS=Cricetulus griseus GN=SAR1B PE=1 SV=1 6 177 5.0E-27
sp|Q5PYH3|SAR1B_PIG GTP-binding protein SAR1b OS=Sus scrofa GN=SAR1B PE=2 SV=1 6 177 5.0E-27
sp|P0C950|SAR1_ASPNG Small COPII coat GTPase SAR1 OS=Aspergillus niger GN=sar1 PE=3 SV=1 8 177 5.0E-27
sp|Q5HZY2|SAR1B_RAT GTP-binding protein SAR1b OS=Rattus norvegicus GN=Sar1b PE=2 SV=1 6 177 5.0E-27
sp|Q3T0T7|SAR1B_BOVIN GTP-binding protein SAR1b OS=Bos taurus GN=SAR1B PE=2 SV=1 6 177 9.0E-27
sp|Q6CWR7|SAR1_KLULA Small COPII coat GTPase SAR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SAR1 PE=3 SV=1 8 177 9.0E-27
sp|Q09654|TRI23_CAEEL E3 ubiquitin-protein ligase arc-1 OS=Caenorhabditis elegans GN=arc-1 PE=3 SV=3 17 179 1.0E-26
sp|Q54Y14|SAR1B_DICDI GTP-binding protein Sar1B OS=Dictyostelium discoideum GN=sarB PE=3 SV=1 5 173 1.0E-26
sp|Q9P4C8|SAR1_PICPG Small COPII coat GTPase SAR1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SAR1 PE=3 SV=1 8 177 3.0E-26
sp|A5E5G3|SAR1_LODEL Small COPII coat GTPase SAR1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SAR1 PE=3 SV=2 8 177 3.0E-26
sp|Q5EA19|ARL15_BOVIN ADP-ribosylation factor-like protein 15 OS=Bos taurus GN=ARL15 PE=2 SV=1 14 174 4.0E-26
sp|Q6BVA7|SAR1_DEBHA Small COPII coat GTPase SAR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SAR1 PE=3 SV=1 8 177 8.0E-26
sp|Q640N2|AR13B_MOUSE ADP-ribosylation factor-like protein 13B OS=Mus musculus GN=Arl13b PE=1 SV=2 16 180 9.0E-26
sp|Q8SQH8|ARF_ENCCU ADP-ribosylation factor OS=Encephalitozoon cuniculi (strain GB-M1) GN=ARF-1 PE=1 SV=3 1 144 1.0E-25
sp|Q8BGR6|ARL15_MOUSE ADP-ribosylation factor-like protein 15 OS=Mus musculus GN=Arl15 PE=1 SV=1 14 180 1.0E-25
sp|Q5RFN0|ARL15_PONAB ADP-ribosylation factor-like protein 15 OS=Pongo abelii GN=ARL15 PE=2 SV=1 14 180 2.0E-25
sp|Q9NXU5|ARL15_HUMAN ADP-ribosylation factor-like protein 15 OS=Homo sapiens GN=ARL15 PE=1 SV=1 14 180 2.0E-25
sp|A5DR82|SAR1_PICGU Small COPII coat GTPase SAR1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SAR1 PE=3 SV=3 8 173 2.0E-25
sp|Q52NJ3|SAR1A_PIG GTP-binding protein SAR1a OS=Sus scrofa GN=SAR1A PE=2 SV=1 6 177 2.0E-24
sp|Q3T0D7|SAR1A_BOVIN GTP-binding protein SAR1a OS=Bos taurus GN=SAR1A PE=2 SV=1 6 177 2.0E-24
sp|Q5R548|SAR1A_PONAB GTP-binding protein SAR1a OS=Pongo abelii GN=SAR1A PE=2 SV=1 6 177 3.0E-24
sp|Q9NR31|SAR1A_HUMAN GTP-binding protein SAR1a OS=Homo sapiens GN=SAR1A PE=1 SV=1 6 177 3.0E-24
sp|Q8IVW1|ARL17_HUMAN ADP-ribosylation factor-like protein 17 OS=Homo sapiens GN=ARL17A PE=2 SV=2 12 85 4.0E-24
sp|P36536|SAR1A_MOUSE GTP-binding protein SAR1a OS=Mus musculus GN=Sar1a PE=1 SV=1 6 177 7.0E-24
sp|P39110|CIN4_YEAST GTP-binding protein CIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN4 PE=1 SV=1 16 178 8.0E-24
sp|Q559R0|SAR1A_DICDI GTP-binding protein Sar1A OS=Dictyostelium discoideum GN=sarA PE=1 SV=1 8 177 9.0E-24
sp|P52885|SAR1_TOBAC GTP-binding protein SAR1 OS=Nicotiana tabacum GN=SAR1 PE=2 SV=1 12 178 2.0E-22
sp|Q1ZXA5|ARLX_DICDI ADP-ribosylation factor-like protein DDB_G0292332 OS=Dictyostelium discoideum GN=DDB_G0292332 PE=3 SV=1 1 144 5.0E-22
sp|Q8JHI3|AR13B_DANRE ADP-ribosylation factor-like protein 13B OS=Danio rerio GN=arl13b PE=1 SV=1 1 180 4.0E-21
sp|Q8MQT8|SAR1_GIAIN GTP-binding protein Sar1 OS=Giardia intestinalis GN=SAR1 PE=3 SV=1 6 173 2.0E-20
sp|Q6T311|ARL9_HUMAN ADP-ribosylation factor-like protein 9 OS=Homo sapiens GN=ARL9 PE=2 SV=1 8 151 1.0E-19
sp|Q9QXJ4|ARL10_MOUSE ADP-ribosylation factor-like protein 10 OS=Mus musculus GN=Arl10 PE=1 SV=2 20 168 3.0E-18
sp|Q8N8L6|ARL10_HUMAN ADP-ribosylation factor-like protein 10 OS=Homo sapiens GN=ARL10 PE=2 SV=1 20 149 2.0E-17
sp|Q8SS09|SAR1_ENCCU Small COPII coat GTPase SAR1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SAR1 PE=1 SV=1 16 132 2.0E-17
sp|Q0P5N6|ARL16_HUMAN ADP-ribosylation factor-like protein 16 OS=Homo sapiens GN=ARL16 PE=1 SV=1 16 176 3.0E-16
sp|Q5H913|AR13A_HUMAN ADP-ribosylation factor-like protein 13A OS=Homo sapiens GN=ARL13A PE=2 SV=2 1 177 6.0E-16
sp|Q54YV7|ARFL_DICDI ADP-ribosylation factor L OS=Dictyostelium discoideum GN=arrL PE=3 SV=1 18 175 7.0E-16
sp|Q9D416|AR13A_MOUSE ADP-ribosylation factor-like protein 13A OS=Mus musculus GN=Arl13a PE=2 SV=1 15 177 4.0E-12
sp|Q6AXT3|AR13A_RAT ADP-ribosylation factor-like protein 13A OS=Rattus norvegicus GN=Arl13a PE=2 SV=1 15 161 2.0E-11
sp|H2L0N8|ARL13_CAEEL ADP-ribosylation factor-like protein 13B OS=Caenorhabditis elegans GN=arl-13 PE=1 SV=1 6 129 4.0E-10
sp|Q54K69|RAB7B_DICDI Ras-related protein Rab-7B OS=Dictyostelium discoideum GN=rab7B PE=3 SV=1 14 132 2.0E-08
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 18 168 5.0E-08
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 18 168 3.0E-07
sp|P16378|GNAO_DROME G protein alpha o subunit OS=Drosophila melanogaster GN=Galphao PE=1 SV=1 44 129 4.0E-07
sp|P38404|GNAO_LOCMI Guanine nucleotide-binding protein G(o) subunit alpha OS=Locusta migratoria PE=3 SV=1 44 129 5.0E-07
sp|Q4FZX7|SRPRB_RAT Signal recognition particle receptor subunit beta OS=Rattus norvegicus GN=Srprb PE=2 SV=1 11 143 5.0E-07
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 14 102 1.0E-06
sp|O15976|GNAO_MIZYE Guanine nucleotide-binding protein G(o) subunit alpha OS=Mizuhopecten yessoensis GN=SCGOA PE=2 SV=3 44 129 1.0E-06
sp|P41776|GNAI_HOMAM Guanine nucleotide-binding protein G(i) subunit alpha OS=Homarus americanus PE=2 SV=2 44 129 1.0E-06
sp|P30683|GNAO_LYMST Guanine nucleotide-binding protein G(o) subunit alpha OS=Lymnaea stagnalis PE=2 SV=3 44 129 2.0E-06
sp|P51877|GNAO_PLATR Guanine nucleotide-binding protein G(o) subunit alpha OS=Planorbella trivolvis PE=2 SV=2 44 129 2.0E-06
sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 19 179 2.0E-06
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 14 102 2.0E-06
sp|P47758|SRPRB_MOUSE Signal recognition particle receptor subunit beta OS=Mus musculus GN=Srprb PE=1 SV=1 11 143 2.0E-06
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 14 102 2.0E-06
sp|Q5UQ27|RABL_MIMIV Probable Rab-related GTPase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R214 PE=3 SV=1 19 179 2.0E-06
sp|P51875|GNAO_CAEEL Guanine nucleotide-binding protein G(o) subunit alpha OS=Caenorhabditis elegans GN=goa-1 PE=1 SV=3 44 129 3.0E-06
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 18 173 4.0E-06
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 18 134 6.0E-06
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 18 134 6.0E-06
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 18 134 6.0E-06
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 17 147 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8337
MGASVSWLSSLLWAKKEIRILILGLDNAGKTTLLYRLKVGEVVTTIPTIGFNVESVSYKNLNFNVWDLGGQTSIR
PYWRCYYANTAAVIFVVDSTDIERLQTAAEELAAMLNEEELKDAALLVFANKQDQPGAKGAGEISEALRLGELRD
RNWSIMACSAVDGSGVNEGMDWLVQTVSQE*
Coding >Hirsu2|8337
ATGGGCGCGAGCGTATCTTGGCTGTCCAGCCTACTGTGGGCAAAGAAGGAGATTAGGATCTTGATTCTGGGTCTC
GACAACGCCGGCAAGACGACTCTGTTATACCGGCTCAAGGTGGGCGAGGTGGTCACGACGATACCCACCATCGGC
TTCAACGTCGAGTCTGTGTCCTACAAGAACCTCAACTTCAATGTCTGGGACCTGGGCGGCCAGACGAGCATCCGG
CCGTACTGGCGGTGCTACTACGCCAACACGGCCGCAGTCATCTTCGTCGTCGACTCGACCGACATCGAGCGGCTA
CAGACGGCCGCCGAGGAGCTGGCCGCCATGCTGAACGAGGAGGAGCTCAAGGACGCGGCCCTCCTGGTCTTCGCC
AACAAGCAGGACCAGCCCGGGGCCAAAGGCGCGGGCGAGATCTCGGAAGCGCTGCGGCTGGGCGAGCTGCGGGAT
CGCAACTGGAGCATCATGGCCTGCTCCGCCGTCGACGGCAGCGGTGTCAACGAGGGCATGGACTGGCTTGTGCAA
ACCGTGTCGCAGGAATGA
Transcript >Hirsu2|8337
ATGGGCGCGAGCGTATCTTGGCTGTCCAGCCTACTGTGGGCAAAGAAGGAGATTAGGATCTTGATTCTGGGTCTC
GACAACGCCGGCAAGACGACTCTGTTATACCGGCTCAAGGTGGGCGAGGTGGTCACGACGATACCCACCATCGGC
TTCAACGTCGAGTCTGTGTCCTACAAGAACCTCAACTTCAATGTCTGGGACCTGGGCGGCCAGACGAGCATCCGG
CCGTACTGGCGGTGCTACTACGCCAACACGGCCGCAGTCATCTTCGTCGTCGACTCGACCGACATCGAGCGGCTA
CAGACGGCCGCCGAGGAGCTGGCCGCCATGCTGAACGAGGAGGAGCTCAAGGACGCGGCCCTCCTGGTCTTCGCC
AACAAGCAGGACCAGCCCGGGGCCAAAGGCGCGGGCGAGATCTCGGAAGCGCTGCGGCTGGGCGAGCTGCGGGAT
CGCAACTGGAGCATCATGGCCTGCTCCGCCGTCGACGGCAGCGGTGTCAACGAGGGCATGGACTGGCTTGTGCAA
ACCGTGTCGCAGGAATGA
Gene >Hirsu2|8337
ATGGGCGCGAGCGTATCTTGGCTGTCCAGCCTACTGTGGGCAAAGAAGGAGATTAGGATCTTGATTCTGGGTCTC
GTGCGTCGCCCGCCGCCCCTGGCTCGGGCCACATGCTGACAGGGCCGTTTGCAGGACAACGCCGGCAAGACGACT
CTGTTATACCGGCTCAAGGTAGGCGTGGCGGAACACGTCGACATCCGGGGCTGACGCGAGTGACGGCGCACAGGT
GGGCGAGGTGGTCACGACGATACCCACCATCGGCTTCAACGTCGAGTCTGTGTCCTACAAGAACCTCAACTTCAA
TGTCTGGGTACGGATAGTGCCCGCGCCGGTGCGAACCACGCCCGTCCCTCGCCACTGACCGGCCATCTCCACAGG
ACCTGGGCGGCCAGACGAGCATCCGGCCGTACTGGCGGTGCTACTACGCCAACACGGCCGCAGTCATCTTCGTCG
TCGACTCGACCGACATCGAGCGGCTACAGACGGCCGCCGAGGAGCTGGCCGCCATGCTGAACGAGGAGGAGCTCA
AGGACGCGGCCCTCCTGGTCTTCGCCAACAAGCAGGACCAGCCCGGGGCCAAAGGCGCGGGCGAGATCTCGGAAG
CGCTGCGGCTGGGCGAGCTGCGGGATCGCAACTGGAGCATCATGGCCTGCTCCGCCGTCGACGGCAGCGGTGTCA
ACGAGGGCATGGACTGGCTTGTGGTGGGCACTCCCCGGGGCGGCGGATCGGATGCATCGCATGCTGACCTGGCTC
GCCAGCAAACCGTGTCGCAGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail